VLDLR Protein, Human (HEK293, His)
Based on 1 Customer Validation
The VLDLR protein is a multifunctional receptor that mediates energy metabolism by binding VLDL and transporting it into cells. It interacts with Reelin/RELN, APOE-containing ligands and clusterin/CLU. VLDLR Protein, Human (HEK293, His) is the recombinant human-derived VLDLR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The VLDLR protein is a multifunctional receptor that mediates energy metabolism by binding VLDL and transporting it into cells. It interacts with Reelin/RELN, APOE-containing ligands and clusterin/CLU. VLDLR Protein, Human (HEK293, His) is the recombinant human-derived VLDLR protein, expressed by HEK293 , with C-His labeled tag.
Background
VLDLR protein, a multifunctional cell surface receptor, plays a pivotal role in energy metabolism by binding to VLDL and facilitating its endocytic transport into cells. Beyond lipid transport, VLDLR exhibits versatile binding capabilities, interacting with a diverse array of molecules, including Reelin/RELN, apolipoprotein E/APOE-containing ligands, and clusterin/CLU. In its inactive state, VLDLR forms homooligomers or heterooligomers with LRP8. Upon ligand binding, homooligomers undergo rearrangement into higher order receptor clusters that transmit the extracellular RELN signal to intracellular signaling pathways by binding to DAB1. This interaction triggers the phosphorylation of DAB1, orchestrating the cellular responses necessary for the accurate positioning of newly generated neurons. Subsequently, VLDLR acts as a stop signal for migrating neurons, preventing their entry into the marginal zone. Notably, in the context of microbial infection, VLDLR serves as a receptor for Semliki Forest virus.
Verified Bioactivity
Human VLDLR, His Tag immobilized on CM5 Chip can bind Human PCSK9, His Tag with an affinity constant of ≤0.72 nM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P98155 (G28-S797)
-
Molecular Construction
-
N-term
-
VLDLR (G28-S797)
Accession # P98155 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
VLDLR; Very Low Density Lipoprotein Receptor; Very Low-Density Lipoprotein Receptor; VLDLRCH; CARMQ1; CHRMQ1; VLDL Receptor; VLDL-R; CAMRQ1
-
AA Sequence
GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTS
-
Predicted Molecular Mass
85.9 kDa
-
Molecular Weight
Approximately 110-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
