YebF Protein, E.coli (Myc, His)
YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.
The YebF protein is observed as a monomer in solution, indicating its individual structural state. Furthermore, YebF interacts with OmpF/OmpC, specifically at the periplasmic face of the membrane. These interactions suggest a potential role for YebF in the context of the bacterial membrane, potentially influencing cellular processes related to membrane dynamics or transport. The monomeric nature of YebF in solution highlights its independent structural form, and further exploration is warranted to elucidate the specific molecular mechanisms and functional implications of its interactions with OmpF/OmpC in the bacterial membrane.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
P33219 (A22-R118)
-
Gene ID946363 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
YebF (A22-R118)
Accession # P33219 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
yebF; b1847; JW1836; Protein YebF
-
AA Sequence
ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR
-
Predicted Molecular Mass
15.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
