YebF Protein, E.coli (Myc, His)

YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of YebF Protein, E.coli (Myc, His) is 97 a.a., with molecular weight of ~15.8 kDa.

The YebF protein is observed as a monomer in solution, indicating its individual structural state. Furthermore, YebF interacts with OmpF/OmpC, specifically at the periplasmic face of the membrane. These interactions suggest a potential role for YebF in the context of the bacterial membrane, potentially influencing cellular processes related to membrane dynamics or transport. The monomeric nature of YebF in solution highlights its independent structural form, and further exploration is warranted to elucidate the specific molecular mechanisms and functional implications of its interactions with OmpF/OmpC in the bacterial membrane.

E.coli

E. coli

N-His;C-Myc

P33219 (22A-118R)

946363  [NCBI]

ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

Approximately 15.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.