ZMYND19 Protein, Human (His)
ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.
Background
ZMYND19 Protein emerges as a potential regulatory molecule in GPR24/MCH-R1 signaling, implying a role in modulating the intricate pathways associated with GPR24/MCH-R1 activation. Its interaction with GPR24/MCH-R1 further supports its involvement in the regulatory processes of this signaling cascade. The specific mechanisms through which ZMYND19 influences GPR24/MCH-R1 signaling and the downstream effects of this interaction remain to be elucidated. Further exploration of ZMYND19's functions and its role in modulating GPR24/MCH-R1 signaling may provide valuable insights into its contributions to cellular responses and potentially offer avenues for targeted interventions in signaling pathways involving G protein-coupled receptors.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96E35 (M1-R227)
-
Gene ID116225 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
ZMYND19 (M1-R227)
Accession # Q96E35 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ZMYND19; Zinc Finger MYND-Type Containing 19; MIZIP; Zinc Finger MYND Domain-Containing Protein 19; MCH-R1-Interacting Zinc Finger Protein; Melanin-Concentrating Hormone Receptor 1 Interacting Zinc-Finger Protein; Melanin-Concentrating Hormone Receptor 1-
-
AA Sequence
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
-
Predicted Molecular Mass
28.6 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
