ZMYND19 Protein, Human (His)

ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZMYND19 Protein, Human (His) is 227 a.a., with molecular weight of ~32.0 kDa.

ZMYND19 Protein emerges as a potential regulatory molecule in GPR24/MCH-R1 signaling, implying a role in modulating the intricate pathways associated with GPR24/MCH-R1 activation. Its interaction with GPR24/MCH-R1 further supports its involvement in the regulatory processes of this signaling cascade. The specific mechanisms through which ZMYND19 influences GPR24/MCH-R1 signaling and the downstream effects of this interaction remain to be elucidated. Further exploration of ZMYND19's functions and its role in modulating GPR24/MCH-R1 signaling may provide valuable insights into its contributions to cellular responses and potentially offer avenues for targeted interventions in signaling pathways involving G protein-coupled receptors.

Human

E. coli

N-6*His

Q96E35 (M1-R227)

116225  [NCBI]

MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.