ZMYND19 Protein, Human (His)

ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ZMYND19 Protein emerges as a potential regulatory molecule in GPR24/MCH-R1 signaling, implying a role in modulating the intricate pathways associated with GPR24/MCH-R1 activation. Its interaction with GPR24/MCH-R1 further supports its involvement in the regulatory processes of this signaling cascade. The specific mechanisms through which ZMYND19 influences GPR24/MCH-R1 signaling and the downstream effects of this interaction remain to be elucidated. Further exploration of ZMYND19's functions and its role in modulating GPR24/MCH-R1 signaling may provide valuable insights into its contributions to cellular responses and potentially offer avenues for targeted interventions in signaling pathways involving G protein-coupled receptors.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • ZMYND19 (M1-R227)
      Accession # Q96E35
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ZMYND19; Zinc Finger MYND-Type Containing 19; MIZIP; Zinc Finger MYND Domain-Containing Protein 19; MCH-R1-Interacting Zinc Finger Protein; Melanin-Concentrating Hormone Receptor 1 Interacting Zinc-Finger Protein; Melanin-Concentrating Hormone Receptor 1-

  • AA Sequence

    MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER

  • Predicted Molecular Mass

    28.6 kDa

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00