ZNF100 Protein, Human (His)

The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNF100 Protein, Human (His) is 108 a.a., with molecular weight of ~15.0 kDa.

The ZNF100 protein emerges as a potential player in transcriptional regulation, suggesting its likely involvement in modulating gene expression. While the specific mechanisms and target genes affected by ZNF100 remain to be fully elucidated, its association with transcriptional processes implies a role in influencing cellular functions through the control of gene expression. The versatile nature of ZNF100 within the realm of transcriptional regulation suggests its potential impact on a variety of cellular pathways, making it an intriguing candidate for further investigation in understanding the intricate dynamics of gene regulation and maintaining cellular homeostasis.

Human

E. coli

N-6*His

Q8IYN0 (R99-K206)

163227  [NCBI]

RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.