ZNF100 Protein, Human (His)
The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag.
The ZNF100 protein emerges as a potential player in transcriptional regulation, suggesting its likely involvement in modulating gene expression. While the specific mechanisms and target genes affected by ZNF100 remain to be fully elucidated, its association with transcriptional processes implies a role in influencing cellular functions through the control of gene expression. The versatile nature of ZNF100 within the realm of transcriptional regulation suggests its potential impact on a variety of cellular pathways, making it an intriguing candidate for further investigation in understanding the intricate dynamics of gene regulation and maintaining cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8IYN0 (R99-K206)
-
Gene ID163227 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
ZNF100 (R99-K206)
Accession # Q8IYN0 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ZNF100; Zinc finger protein 100; ZNF100 Protein; Zinc Finger Protein 100 (Y1)
-
AA Sequence
RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
