ZNF70 Protein, Human (His)

The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNF70 Protein, Human (His) is 446 a.a., with molecular weight of ~60.0 kDa.

The ZNF70 protein emerges as a potential participant in transcriptional regulation, indicating its likely involvement in modulating gene expression. Although the specific mechanisms and target genes influenced by ZNF70 are yet to be fully elucidated, its association with transcriptional processes suggests a role in shaping cellular functions through the regulation of gene expression. The versatile nature of ZNF70 within the context of transcriptional regulation hints at its potential impact on diverse cellular pathways, making it a compelling subject for further exploration to unravel its role in the intricate dynamics of gene regulation and maintenance of cellular homeostasis.

Human

E. coli

N-6*His

Q9UC06 (M1-L446)

7621  [NCBI]

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Approximately 60.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.