ZNHIT1 Protein, Human (His)
ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag.
ZNHIT1 emerges as a pivotal player in chromatin remodeling, exerting its influence on gene expression regulation by facilitating the incorporation of histone variant H2AZ1/H2A.Z into the genome. In the context of muscle differentiation, ZNHIT1 is recruited to the promoter of the transcriptional activator MYOG, where it mediates the binding of histone H2AZ1 to chromatin, inducing muscle-specific gene expression. Notably, ZNHIT1 demonstrates its versatility by maintaining hematopoietic stem cell (HSC) quiescence through the modulation of chromatin accessibility at enhancers of quiescence genes. Additionally, ZNHIT1 contributes to intestinal stem cell maintenance by promoting H2AZ1 deposition at key gene transcription start sites. In the realm of meiosis, ZNHIT1's control over H2AZ1 deposition aids in the initiation of this essential process. The multifaceted role of ZNHIT1 extends to postnatal heart function, where it maintains cardiac Ca(2+) homeostasis and influences the expression of Ca(2+)-regulating proteins. Further, ZNHIT1 participates in TP53/p53-mediated apoptosis, cell cycle regulation, lens fiber cell differentiation, and neurite growth. Interactions with various proteins, including MAPK11, MAPK14, NR1D1, NR2D2, and the chromatin-remodeling SRCAP complex, underscore ZNHIT1's intricate involvement in diverse cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O43257 (M1-V154)
-
Molecular Construction
-
N-term
-
6*His
-
ZNHIT1 (M1-V154)
Accession # O43257 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ZNHIT1; Zinc Finger Protein Subfamily 4A Member 1; Prev. ZNFN4A1; Zinc Finger, HIT Domain Containing 1; H_DJ0747G18.14; Cyclin-G1-Binding Protein 1; P18(Hamlet); P18 Hamlet; CG1I; Zinc Finger, HIT Type 1; Zinc Finger Protein, Subfamily 4A (HIT Domain Cont
-
AA Sequence
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)