1. Recombinant Proteins
  2. Others
  3. ZNHIT1 Protein, Human (His)

ZNHIT1 Protein, Human (His)

Cat. No.: HY-P71028
Handling Instructions

ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNHIT1 Protein, Human (His) is 154 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ZNHIT1 is a key chromatin remodeling protein that regulates gene expression by promoting the incorporation of histone variants H2AZ1/H2A.Z. In muscle differentiation, ZNHIT1 is recruited to the MYOG promoter, mediating H2AZ1 binding and inducing muscle-specific gene expression. ZNHIT1 Protein, Human (His) is the recombinant human-derived ZNHIT1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNHIT1 Protein, Human (His) is 154 a.a., with molecular weight of ~21.0 kDa.

Background

ZNHIT1 emerges as a pivotal player in chromatin remodeling, exerting its influence on gene expression regulation by facilitating the incorporation of histone variant H2AZ1/H2A.Z into the genome. In the context of muscle differentiation, ZNHIT1 is recruited to the promoter of the transcriptional activator MYOG, where it mediates the binding of histone H2AZ1 to chromatin, inducing muscle-specific gene expression. Notably, ZNHIT1 demonstrates its versatility by maintaining hematopoietic stem cell (HSC) quiescence through the modulation of chromatin accessibility at enhancers of quiescence genes. Additionally, ZNHIT1 contributes to intestinal stem cell maintenance by promoting H2AZ1 deposition at key gene transcription start sites. In the realm of meiosis, ZNHIT1's control over H2AZ1 deposition aids in the initiation of this essential process. The multifaceted role of ZNHIT1 extends to postnatal heart function, where it maintains cardiac Ca(2+) homeostasis and influences the expression of Ca(2+)-regulating proteins. Further, ZNHIT1 participates in TP53/p53-mediated apoptosis, cell cycle regulation, lens fiber cell differentiation, and neurite growth. Interactions with various proteins, including MAPK11, MAPK14, NR1D1, NR2D2, and the chromatin-remodeling SRCAP complex, underscore ZNHIT1's intricate involvement in diverse cellular pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O43257 (M1-V154)

Gene ID
Synonyms
inc finger HIT domain-containing protein 1; cyclin-G1-binding protein 1; zinc finger protein subfamily 4A member 1; p18 hamlet; CGBP1; ZNFN4A1; ZNHIT1
AA Sequence

MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ZNHIT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZNHIT1 Protein, Human (His)
Cat. No.:
HY-P71028
Quantity:
MCE Japan Authorized Agent: