β-Amyloid (1-40), HFIP-treated TFA

Name: β-Amyloid (1-40), HFIP-treated TFA
Brand: MedChemExpress
SKU: HY-P0265C
Rating: 5.0 (2 reviews)

Cat. No.: HY-P0265C Purity: 99.27%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

β-Amyloid (1-40), HFIP-treated is a β-Amyloid (1-40) (HY-P0265A) treated with HFIP. β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40), HFIP-treated TFA Chemical Structure

Size	Price	Stock	Quantity
1 mg		In-stock	Estimated Time of Arrival: December 31
5 mg (1 mg * 5)		In-stock	Estimated Time of Arrival: December 31

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-40), HFIP-treated TFA:

β-Amyloid (1-40) (human) TFA In-stock

2 Publications Citing Use of MCE β-Amyloid (1-40), HFIP-treated TFA

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

β-Amyloid (1-40), HFIP-treated is a β-Amyloid (1-40) (HY-P0265A) treated with HFIP. β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease^[1].

In Vivo

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

β-Amyloid (1-40) can be used in animal modeling to create Alzheimer's disease models.

Induction of Alzheimer's disease^[2]

Background

β-Amyloid (1-40) induces Alzheimer's disease by accumulating in the brain and being neurotoxic.

Specific Modeling Methods

Rat: Wistar • male • 280-320 g
Administration: 0, 3, 30, 300 pmol • connection of cannulae to modified micro-osmotic pumps for infusion • 2 weeks

Note

(1) Dissolve β-Amyloid (1-40) in 35% acetonitrile/0.1% trifluoroacetic acid (TFA).
(2) In each group of 7 rats, a catheter was placed into the left ventricle on day 1. A water maze task was performed on days 9-13 after the start of infusion. At the end of the behavioural experiments, 4 rats from each group were taken from each group and processed by severing their heads for ChAT activity assay. Three rats were taken for histochemical studies.
(3) In histochemical studies, rats were anaesthetised and executed by transaortic perfusion fixation, first in cold saline and then in 4% paraformaldehyde and 0.1 M sodium phosphate buffer. Brains were removed and fixed in the same fixative for 12 hours. Frozen brain tissue was cut at 20 μm using a cryostat and the periventricular region was collected.

Modeling Indicators

Molecular changes: The activity of acetyltransferase (ChAT) in the frontal cortex and hippocampus is reduced, and cholinergic neuron dysfunction occurs.
Organizational changes: Accumulation of β-Amyloid in the hippocampus and cerebral cortex.
Phenotypic observation: Memory impairment occurs.

Correlated Product(s): /

Opposite Product(s): /

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4329.80 (free base)

Formula

C₁₉₄H₂₉₅N₅₃O₅₈S.xC₂HF₃O₂

Appearance

Oil

Color

Colorless to light yellow

Sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Pure form	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 99.27%

Select Batch:

Data Sheet (293 KB) SDS (252 KB)

COA (266 KB) RP-HPLC (276 KB) MS (72 KB)

Handling Instructions (2659 KB)

References

[1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006. [Content Brief]

[2]. Nitta A, et al. β-Amyloid protein-induced Alzheimer's disease animal model[J]. Neuroscience letters, 1994, 170(1): 63-66.