1. Peptides

Amyloid β-peptide (1-40) rat 

Cat. No.: HY-P1387 Purity: 95.06%
Handling Instructions

Amyloid β-peptide (1-40) (rat) is the prone-to-aggregation product of amyloid precursor protein proteolytic cleavage, and is the major constituent of senile plaques observed in the brain of Alzheimer’s disease. Sequence: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val;DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Amyloid β-peptide (1-40) rat Chemical Structure

Amyloid β-peptide (1-40) rat Chemical Structure

CAS No. : 144409-98-3

Size Price Stock Quantity
1 mg USD 200 In-stock
Estimated Time of Arrival: December 31
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Description

Amyloid β-peptide (1-40) (rat) is the prone-to-aggregation product of amyloid precursor protein proteolytic cleavage, and is the major constituent of senile plaques observed in the brain of Alzheimer’s disease. Sequence: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val;DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV.

IC50 & Target

The Amyloid β-peptide (1-40) (rat)-treated rats require longer to find the platform hidden under the water. In the visible platform test, the latency for each group is similar (20.56±11.31 s in control and 14.68±9.97 s in Amyloid β-peptide (1-40) (rat) group, p=0.304). Among these tested proteins, 6 ones are significantly up-regulated and 7 ones significantly down-regulated in Amyloid β-peptide (1-40) (rat) group comparing with the control. Tubulin β chain is significantly down-regulated in Amyloid β-peptide (1-40) (rat) group (p=0.014) when compare with control. Similar changes are also observed for ATP synthase β subunit (p=0.010) and synapsin Ib between Amyloid β-peptide (1-40) (rat) and control groups, but not significantly for synapsin Ib (p=0.295)[1].

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
Animal Administration
[1]

Eight-week-old male Sprague-Dawley rats (n=14) weighing 200 to 220 g are used in this study. The rats are housed in plastic cages with food and water supplied ad libitum, and are maintained on a 12-h light/dark cycle at room temperature (21 to 23°C). 14 rats are randomly divided into two groups: (1) Milli-Q water-injected rats serve as the control group and (2) fibrillar neurotoxic Amyloid β-peptide (1-40) (rat) injected rats serve as the Amyloid β-peptide (1-40) (rat) group. Fibrillar Amyloid β-peptide (1-40) (rat) or Milli-Q water (2 μL) is injected at a flow rate of 0.5 μL/min. Following injection, the needle is maintained in place for 5 min prior to its slow extraction. A second injection is also administered at the same coordinate in the opposite hemisphere. The behavioral performances of animals are assessed by the step-down passive avoidance test and Morris water maze test[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
Molecular Weight

4233.76

Formula

C₁₉₀H₂₉₁N₅₁O₅₇S

CAS No.

144409-98-3

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amyloid β-peptide (1-40) rat
Cat. No.:
HY-P1387
Quantity:

Amyloid β-peptide (1-40) rat

Cat. No.: HY-P1387