β-Amyloid (1-40) (rat)
Based on 2 publication(s) in Google Scholar
β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.
For research use only. We do not sell to patients.
- CAS No.: 144409-98-3
- Formula: C190H291N51O57S
- Molecular Weight:4233.76
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* The compound is unstable in solutions, freshly prepared is recommended.
Publications Citing Use of MedChemExpress (MCE) β-Amyloid (1-40) (rat)
More
Biological Activity
Description
In Vitro
β-Amyloid (1-40) (rat) (1 μM; 1 h) increases 45Ca2+ influx and elevates Ca2+ in cortical synaptosomes[1].
β-Amyloid (1-40) (rat) (3 nM) induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield and induces apoptosis[2].
β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide is dissolved in cold hexafluoro-2-propanol (HFIP). The peptide is incubated at room temperature for at least 1 h to establish monomerization and randomization of structure.
2. The HFIP is removed by evaporation, and the resulting peptide is stored as a film at -20 or -80 °C.
3. The resulting film is dissolved in anhydrous DMSO at 5 mM and then dilutes into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution is age 48 h at 4-8 °C. The sample is then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers are in the supernatant. The supernatant is diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Swiss and C57BL/6 mice[3]
-
Dosage:1.7 mg
-
Administration:Intracerebroventrical injection; for 7 days
-
Result:Presented spatial learning and memory impairments.
Chemical Information
-
CAS No. 144409-98-3
-
Appearance Solid
-
Molecular Weight 4233.76
-
Formula C190H291N51O57S
-
Color White to off-white
-
Sequence
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
-
Sequence Shortening
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * The compound is unstable in solutions, freshly prepared is recommended.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Sci Rep
Amyloid-β slows cilia movement along the ventricle, impairs fluid flow, and exacerbates its neurotoxicity in explant culture. [Abstract]2023 Aug 21;13(1):13586. PMID: 37605005 -
Med Phys
Cerebrovascular mechanisms between type 2 diabetes and Alzheimer's disease: Insights from ultrasound localization microscopy. [Abstract]2025 Nov;52(11):e70131. PMID: 41206345
Solvent & Solubility
In Vitro:
DMSO : 50 mg/mL (11.81 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (273 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. MacManus A, et, al. Enhancement of (45)Ca(2+) influx and voltage-dependent Ca(2+) channel activity by beta-amyloid-(1-40) in rat cortical synaptosomes and cultured cortical neurons. Modulation by the proinflammatory cytokine interleukin-1beta. J Biol Chem. 2000 Feb 18;275(7):4713-8. [Content Brief]
[2]. Miguel-Hidalgo JJ, et, al. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 1998 May;95(5):455-65. [Content Brief]
[3]. Prediger RD, et, al. Differential susceptibility following beta-amyloid peptide-(1-40) administration in C57BL/6 and Swiss albino mice: Evidence for a dissociation between cognitive deficits and the glutathione system response. Behav Brain Res. 2007 Feb 27;177(2):205-13. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2362 mL | 1.1810 mL | 2.3620 mL | 5.9049 mL |
| 5 mM | 0.0472 mL | 0.2362 mL | 0.4724 mL | 1.1810 mL | |
| 10 mM | 0.0236 mL | 0.1181 mL | 0.2362 mL | 0.5905 mL |