1. Peptides
    Others
  2. Exendin-3

Exendin-3 

Cat. No.: HY-P1543
Handling Instructions

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn .

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Exendin-3 Chemical Structure

Exendin-3 Chemical Structure

CAS No. : 130357-25-4

Size Price Stock
500 μg USD 220 Get quote
1 mg USD 320 Get quote
5 mg USD 990 Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn .

IC50 & Target

VIP receptor, putative exendin receptor[1]

In Vitro

Exendin-3 interacts with at least two receptors on guinea pig pancreatic acini; at high concentrations (>100 nM) the peptide interacts with VIP receptors, thereby causing a large increase in cAMP and stimulating amylase release; at lower concentrations (0.1-3 nM) the peptide interacts with a putative exendin receptor, thereby causing a smaller increase in cAMP of undetermined function[1].

Molecular Weight

4202.57

Formula

C₁₈₄H₂₈₂N₅₀O₆₁S

CAS No.

130357-25-4

Sequence

His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Sequence Shortening

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
Kinase Assay
[1]

Effect of increasing concentrations of two VIP receptor antagonists on the increase in amylase release are observed with VIP, secretin, or exendin-3. Male Hartley guinea pigs Acini were incubated with VIP (1 nM), secretin (1 μM), or Exendin-3 (1 μM) for 30 min at 37°C, alone or in combination with indicated concentrations of [AcTyr, D-Phe]GRF 1-29 amide (solid symbols) or [4-Cl-D-Phe,Leu] VIP (open symbols)[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exendin-3
Cat. No.:
HY-P1543
Quantity: