2. GPCR/G Protein
  3. PACAP Receptor
  4. PACAP (1-27), human, ovine, rat

PACAP (1-27), human, ovine, rat  (Synonyms: PACAP 1-27)

Art. -Nr.: HY-P0176 Reinheit: 99.30%
COA
SDS
Handling Instructions Technical Support

PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor agonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

PACAP (1-27), human, ovine, rat

PACAP (1-27), human, ovine, rat Chemische Struktur

CAS. Nr. : 127317-03-7

Größe Preis Verfügbarkeit Menge
500 μg Auf Lager
1 mg Auf Lager
5 mg Auf Lager
10 mg Auf Lager
50 mg   Angebot einholen  
100 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 3 publication(s) in Google Scholar

Other Forms of PACAP (1-27), human, ovine, rat:

PACAP (1-27), human, ovine, rat Related Antibodies

Top Publications Citing Use of Products

Alle PACAP Receptor Isoform-spezifische Produkte anzeigen:

Alle Isoformen anzeigen
PAC1 Receptor VPAC2 receptor

  • Biologische Aktivität

  • Protokoll

  • Reinheit & Dokumentation

  • Verweise

  • Kundenbewertung

Beschreibung

PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor agonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively[1].

IC50 & Target

IC50: 3 nM (rat PAC1), 2 nM (rat VPAC1), 5 nM (human VPAC2)[1]
In Vitro

Radioligand receptor binding assays with I-monoiodinated PACAP (1-27), human, ovine, rat confirms the presence of PAC -receptors on AR4-2J cells, since PACAP (1-27), human, ovine, rat and PACAP(1–38) equipotently displaces radioligand binding with a Kd of 1-2 nM, whereas vasoactive intestinal peptide (VIP) is 1000-fold less potent. PACAP (1-27), human, ovine, rat exhibits a distinct and much higher susceptibility to VIP-amino acid substitutions. PACAP (1-27), human, ovine, rat has potency and binding affinity to stimulate IP3 and cAMP formation in AR4-2J cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

PACAP (1-27), human, ovine, rat Related Antibodies
In Vivo

The inhibitory effect of pituitary adenylate cyclase activating polypeptide (PACAP (1-27), human, ovine, rat) on the increase in total pulmonary resistance (RL) causes either by allergen or histamine in anaesthetized, ventilated guinea-pigs is studied. PACAP (1-27), human, ovine, rat given via i.v. infusion (0.045-4.5 nmol/kg/min) dose-dependently reduces the increase in RL caused by inhaled ovalbumin and histamine. At the highest dose, PACAP (1-27), human, ovine, rat prevented the increase in RL caused by ovalbumin and histamine completely. Infusion of PACAP (1-27), human, ovine, rat and the β2-adrenoceptor agonist, salbutamol (0.045-4.5 nmol/kg/min) inhibit the increase in RL similarly, but salbutamol increases the heart rate more than PACAP (1-27), human, ovine, rat[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molekulargewicht

3147.66

Formel

C142H224N40O39S
CAS. Nr.
Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Lösungsmittel & Löslichkeit
In Vitro: 

DMSO : 100 mg/mL (31.77 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : ≥ 50 mg/mL (15.88 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3177 mL 1.5885 mL 3.1770 mL
5 mM 0.0635 mL 0.3177 mL 0.6354 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molaritätsrechner

  • Verdünnungsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Reinheit & Dokumentation

Purity: 99.30%

SDS (393 KB)

COA (242 KB) RP-HPLC (251 KB) MS (70 KB)

Handling Instructions (2659 KB)
Verweise
Tierverwaltung
[3][4]

Guinea-pigs[3]

PACAP-27 (0.045 to 4.5 nmol/kg/min), salbutamol (0.045 to 4.5 nmol/kg/min) or sterile saline is given i.v. (1.0 mL) via an infusion pump, starting 5 min before and continuing 10 min after airway challenge[3].

Dogs[4]

Four dogs (28.4±1.8 kg) receive PACAP (1-27) with four different concentrations of 0.01, 0.1, 1.0 and 10 µg/mL, or 0.00318, 0.0318, 0.318 and 3.18 µM, respectively. Each solution is locally infused at a rate of 0.5 mL/min for precisely 1 min. A total dose delivered to the pancreas during each infusion is therefore 0.005, 0.05, 0.5 and 5 µg. The dead volume of the pancreatic arterial catheter (0.5 mL) is taken into account in relation to the infusion rate. After taking the initial control sample, simultaneously from the SPD vein and the aorta, saline is infused for 1 min and samples are obtained 1, 3 and 5 min after the onset of infusion. This procedure is repeated every 15 min for the doses of PACAP (1-27). The sample obtained at 15 min after the onset of each infusion served as control for the subsequent intervention[4].

MCE hat die Genauigkeit dieser Methoden nicht unabhängig bestätigt. Sie dienen nur als Referenz.
Verweise

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.3177 mL 1.5885 mL 3.1770 mL 7.9424 mL
5 mM 0.0635 mL 0.3177 mL 0.6354 mL 1.5885 mL
10 mM 0.0318 mL 0.1588 mL 0.3177 mL 0.7942 mL
15 mM 0.0212 mL 0.1059 mL 0.2118 mL 0.5295 mL
DMSO 20 mM 0.0159 mL 0.0794 mL 0.1588 mL 0.3971 mL
25 mM 0.0127 mL 0.0635 mL 0.1271 mL 0.3177 mL
30 mM 0.0106 mL 0.0529 mL 0.1059 mL 0.2647 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

PACAP (1-27), human, ovine, rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

PACAP (1-27), human, ovine, rat127317-03-7PACAP 1-27PACAP ReceptorPituitary adenylyl cyclase activating polypeptide receptorInhibitorinhibitorinhibit

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Produktname

  

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

      

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
PACAP (1-27), human, ovine, rat
Art. -Nr.:
HY-P0176
Menge:
MCE Japan Authorized Agent:

Kundenbewertung

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Produktname

  

Lot #

Name des Antragstellers *

 

E-Mail-Addresse *

Telefonnummer

 

Department *

Name der Organisation *

 

Country or Region *

Bemerkungen

SAFETY DATA SHEET (SDS)

English - EN (393 KB) Français - FR (393 KB) Deutsch - DE (393 KB) Norwegian - NO (393 KB) Español - ES (393 KB) Swedish - SV (393 KB) Italian - IT (393 KB) Korean - KR (393 KB) Portuguese - PT (393 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.