Agouti-related Protein (AGRP) (83-132) Amide (human)

Cat. No.: HY-P3561: Ficha de datos Instrucciones de manejo
FAQs
Technical Support

Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake.

Para uso exclusivo en investigación. No vendemos a pacientes.

Agouti-related Protein (AGRP) (83-132) Amide (human) Estructura química

Tamaño		Stock
MOQ		Minimum order quantity
50 mg		Obtener un presupuesto
100 mg		Obtener un presupuesto
250 mg		Obtener un presupuesto
Other size		Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Agouti-related Protein (AGRP) (83-132) Amide (human):

Agouti-related Protein (AGRP) (83-132) Amide (human) TFA

Other Forms of Agouti-related Protein (AGRP) (83-132) Amide (human):

Agouti-related Protein (AGRP) (83-132) Amide (human) TFA In-stock

Recomendaciones destacadas

•Related Small Molecules:

•Related Proteins:

Ver todos los productos específicos de isoformas Melanocortin Receptor:

Ver todas las isoformas

MC1R MC3R MC2R MC4R MC5R

Actividad biológica
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

IC₅₀ & Target^[2]

MC4R

In Vivo

Agouti-related Protein (AGRP) (83-132) increases food intake and decreases spontaneous locomotor activity in rats^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male Sprague Dawley rats (250-300 g)^[2]
Dosage:	5.0 μg
Administration:	icv; single dosage
Result:	Increased food intake within 72 hours of administration, and decreased spontaneous locomotor activity.

Peso molecular

5676.60

Fòrmula

C₂₃₅H₃₆₂N₇₆O₆₇S₁₁

Sequence

Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8)

Sequence Shortening

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8)

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvente y solubilidad

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Pureza y Documentación

Instrucciones de manejo (2659 KB)

Referencias

[1]. Donald W. Pfaff, et al. Chapter 1 - Hormones Can Facilitate or Suppress Behaviors. Principles of Hormone/Behavior Relations (Second Edition). Academic Press, 2018, Pages 3-26, ISBN 9780128113714.

[2]. Tang-Christensen M, et al. Central administration of ghrelin and agouti-related protein (83-132) increases food intake and decreases spontaneous locomotor activity in rats. Endocrinology. 2004 Oct;145(10):4645-52. [Content Brief]