1. Membrane Transporter/Ion Channel
  2. Potassium Channel
  3. BeKm-1

BeKm-1 

Cat. No.: HY-P1440
Handling Instructions

BeKm-1 is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 dose-dependently prolongs QTc interval in isolated rabbit heart.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

BeKm-1 Chemical Structure

BeKm-1 Chemical Structure

CAS No. : 524962-01-4

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of BeKm-1:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

BeKm-1 is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 dose-dependently prolongs QTc interval in isolated rabbit heart.

Molecular Weight

4091.65

Formula

C₁₇₄H₂₆₁N₅₁O₅₂S₆

CAS No.

524962-01-4

Sequence

Arg-Pro-Thr-Asp-Ile-Lys-Cys-Ser-Glu-Ser-Tyr-Gln-Cys-Phe-Pro-Val-Cys-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys-Val-Asn-Gly-Phe-Cys-Asp-Cys-Phe (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)

Sequence Shortening

RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

BeKm-1BeKm1BeKm 1Potassium ChannelKcsAInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
BeKm-1
Cat. No.:
HY-P1440
Quantity:
MCE Japan Authorized Agent: