BeKm-1 TFA
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
For research use only. We do not sell to patients.
- Formula: C174H261N51O52S6.xC2HF3O2
- Molecular Weight:4091.65 (free acid)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Chemical Information
-
Molecular Weight 4091.65 (free acid)
-
Formula C174H261N51O52S6.xC2HF3O2
-
Sequence
Arg-Pro-Thr-Asp-Ile-Lys-Cys-Ser-Glu-Ser-Tyr-Gln-Cys-Phe-Pro-Val-Cys-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys-Val-Asn-Gly-Phe-Cys-Asp-Cys-Phe (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)
-
Sequence Shortening
RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)