1. Peptides
  2. Peptide and Derivatives
  3. Hormones and Neuropeptides
  4. Corticotropin-releasing factor (Sheep)

Corticotropin-releasing factor (Sheep)  (Synonyms: CRH (Sheep))

Cat. No.: HY-P3538 Purity: 99.67%
Handling Instructions Technical Support

Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

Corticotropin-releasing factor (Sheep)

Corticotropin-releasing factor (Sheep) 화학구조

CAS No. : 9015-71-8

사이즈 가격 재고 수량
1 mg 해외재고보유
5 mg 해외재고보유
10 mg 해외재고보유
50 mg   견적 받기  
100 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

고객리뷰

Based on 1 Customer Validation

Top Publications Citing Use of Products
  • Biological Activity

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

Corticotropin-releasing factor (CRH) (Sheep) is a brain-penetrant hypothalamic releasing factor and a peptide hormone with analgesic and arousal-inducing activity. Corticotropin-releasing factor (Sheep) mediates stress effects, including stress-induced analgesia. Corticotropin-releasing factor (Sheep) increases wakefulness, reduces slow wave sleep, alters EEG frequency content, stimulates ACTH and β-endorphin release, activates locomotor activity. Corticotropin-releasing factor (Sheep) can be used for the research of neurological disease[1][2].

In Vivo

Corticotropin-releasing factor (Sheep) (4-32 μg; i.v.; single dose) produces analgesia in male Wistar rats tested via the tail flick test[1].
Corticotropin-releasing factor (Sheep) (23-118 μg/kg; i.v.; single dose) produces analgesia in male SD rats tested via the hot plate test, with an ED50 of 10 nmol/kg[1].
Corticotropin-releasing factor (Sheep) (4-14 μg; i.v.; single dose or 0.4-2.5 μg; intradermal into hindpaw; single dose) produces analgesia in anaesthetized male albino rats tested via the paw flick assay with 48°C water immersion[1].
Corticotropin-releasing factor (Sheep) (10-40 μg/kg; i.v.; single dose or 100-200 ng; intracisternal; single dose) produces analgesia in female Std:ddy mice tested via the phenylquinone writhing assay[1].
Corticotropin-releasing factor (Sheep) (29-86 μg/kg; i.v.; single dose) produces antinociception in anaesthetized male SD rats, with an ED50 of 2.3-7 nmol/kg, as measured by reduced trigeminal neuron responses to noxious heat[1].
Corticotropin-releasing factor (Sheep) (0.1-1.5 ng; intraplantar into inflamed hindpaw; single dose) reduces CFA-induced hyperalgesia in the inflamed hindpaw of male Wistar rats, with an ED50 of 1.59 ng, via a mechanism involving immune cell-derived β-endorphin[1].
Corticotropin-releasing factor (Sheep) (0.7 μg; i.c.v.; single dose) produces analgesia in male Wistar rats tested via the formalin test[1].
Corticotropin-releasing factor (Sheep) (0.0015-0.015 nmol; i.c.v.; single injection) produces dose-dependent increases in arousal, marked by 91.3% and 93.8% reductions in slow wave sleep time, respectively, and corresponding shifts in cortical EEG frequency power in male Sprague-Dawley rats[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague-Dawley (SD) rats (male)[1]
Dosage: 23-118 μg/kg
Administration: i.v.; single dose
Result: Produced significant analgesia in the hot plate test at 118 μg/kg.
Produced analgesia with an ED50 of 10 nmol/kg at doses of 5-25.2 nmol/kg.
Animal Model: Sprague-Dawley (male, 200-350 g)[2]
Dosage: 0.0015 nmol; 0.015 nmol
Administration: i.c.v.; single injection
Result: Reduced slow wave sleep (SWS) time by 91.3% to a mean of 5.8 ± 5.8% of the 30-minute scored epoch.
Decreased 1-2 Hz, 2-4 Hz, and 4-6 Hz cortical EEG power.
Increased 32-64 Hz cortical EEG power.
Reduced slow wave sleep (SWS) time by 93.8% to a mean of 3.4 ± 3.4% of the 30-minute scored epoch .
Decreased 16-32 Hz cortical EEG power.
Increased 32-64 Hz cortical EEG power.
분자량

4670.31

화학식

C205H339N59O63S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

Sequence Shortening

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

용액&용해도
In Vitro: 

DMSO : ≥ 2 mg/mL (0.43 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

  • 몰농도 계산기

  • 농도 희석 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
순도&문서

Purity: 99.67%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Corticotropin-releasing factor (Sheep)
Cat. No.:
HY-P3538
수량:
MCE Japan Authorized Agent: