1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Adrenomedullin
  5. Adrenomedullin/ADM Protein, Human (HEK293, Fc)

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilator agents that mainly affect fluid and electrolyte homeostasis. In the kidney, ADM has diuretic and natriuretic effects, while both ADM and PAMP directly inhibit aldosterone secretion in the adrenal gland. Adrenomedullin/ADM Protein, Human (HEK293, Fc) is the recombinant human-derived Adrenomedullin/ADM protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilator agents that mainly affect fluid and electrolyte homeostasis. In the kidney, ADM has diuretic and natriuretic effects, while both ADM and PAMP directly inhibit aldosterone secretion in the adrenal gland. Adrenomedullin/ADM Protein, Human (HEK293, Fc) is the recombinant human-derived Adrenomedullin/ADM protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilatory agents with numerous reported actions primarily linked to the physiological control of fluid and electrolyte homeostasis. In the kidney, ADM exhibits diuretic and natriuretic effects, while both ADM and PAMP inhibit aldosterone secretion through direct actions on the adrenal glands. In the pituitary gland, both peptides, at physiologically relevant doses, inhibit basal ACTH secretion. Furthermore, ADM and PAMP seem to act in the brain and pituitary gland, facilitating the loss of plasma volume, actions that complement their hypotensive effects in blood vessels. These multifaceted actions underscore the role of ADM in regulating cardiovascular and hormonal processes associated with fluid and electrolyte balance.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P35318 (Y95-Y146)

Gene ID

133  [NCBI]

Molecular Construction
N-term
hFc
ADM (Y95-Y146)
Accession # P35318
C-term
Protein Length

Full Length of mature protein?

Synonyms
Pro-adrenomedullin; ADM; Adrenomedullin; AM; PAMP
AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Molecular Weight

Approximately 39, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Adrenomedullin/ADM Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Adrenomedullin/ADM Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin/ADM Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74426
Quantity:
MCE Japan Authorized Agent: