1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin D
  5. Cathepsin D Protein, Cricetulus griseus (His-SUMO)

Cathepsin D Protein, Cricetulus griseus (His-SUMO)

Cat. No.: HY-P72155
Handling Instructions Technical Support

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Cathepsin D Protein, Cricetulus griseus (His-SUMO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

Cathepsin D is over-expressed and hyper-secreted by epithelial breast cancer cells. Cathepsin D is an independent marker of poor prognosis in breast cancer. Cathepsin D is also a key mediator of induced-apoptosis and its proteolytic activity has been involved generally in this event[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

G3I4W7 (G65-L408)

Gene ID

100766628  [NCBI]

Molecular Construction
N-term
6*His-SUMO
Cathepsin D (G65-L408)
Accession # G3I4W7
C-term
Protein Length

Partial

Synonyms
Cathepsin D; H671_3g9701
AA Sequence

GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL

Predicted Molecular Mass
53.3 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

Cathepsin D Protein, Cricetulus griseus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cathepsin D Protein, Cricetulus griseus (His-SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Cricetulus griseus (His-SUMO)
Cat. No.:
HY-P72155
Quantity:
MCE Japan Authorized Agent: