1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-1/CCL2
  6. MCP-1/CCL2 Protein, Mouse

MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
> 500 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

    MCP-1/CCL2 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753.  [Abstract]

    Representative photomicrographs of the migratory wild-type BMDMs (stained with crystal violet) following treatment MSC with MCP-1/CCL2 Protein (200 ng/mL), IL-17B (200 ng/mL) or PBS (control) for 24 h in 24-well transwell lower chambers. The number of migratory cells was determined.

    MCP-1/CCL2 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753.  [Abstract]

    SNs of II17b-/- mice were injected with recombinant MCP-1/CCL2 Protein (1 mg/nerve) and then subjected to crush injury for 3 days. MCP-1/CCL2 Protein can effectively restore macrophage recruitment in II17b-/- mice.

    MCP-1/CCL2 Protein, Mouse purchased from MCE. Usage Cited in: Biomolecules. 2024 Sep 3;14(9):1109.  [Abstract]

    Spiking healthy control plasma with MCP-1/CCL2 Protein (5 μg/mL), followed by microcontact printing and detection via immunofluorescence, clearly revealed MCP-1/CCL2 Protein-specific microcontact-printed lanes compared to the control without MCP-1/CCL2 Protein in the plasma.

    MCP-1/CCL2 Protein, Mouse purchased from MCE. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114.  [Abstract]

    Oil Red O staining of the adipogenic potential of 2-week-old ASCs cultured with differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) was performed. MCP-1/CCL2 Protein significantly promoted the adipogenic differentiation capability of ASCs, resulting in more lipid droplet formation.

    MCP-1/CCL2 Protein, Mouse purchased from MCE. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114.  [Abstract]

    Protein levels of p-AKT, AKT, and β-catenin in ASCs cultured in adipogenic differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) were measured by western blot. MCP-1/CCL2 Protein significantly increased the expression level of p-AKT and decreased the expression level of β-catenin.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil[1].

    Background

    CCL2, also known as monocyte chemotactic protein 1 (MCP1), is a small cell factor belonging to the CC chemokine family. The CCL2 gene, located in the q11.2-q12 region of human chromosome 17, encodes a monomeric polypeptide with a molecular weight of 9-15 kDa, depending on the level of glycosylation. CCL2 is mainly secreted by monocytes, macrophages and dendritic cells. It is secreted by monocytes, macrophages and dendritic cells, and platelet-derived growth factor is the main inducer of the CCL2 gene. Astrocytes and microglia are also thought to be the source of CCL2[1]. CCL2 signals through binding to and activation of CCR2 and induces a strong chemotactic response and intracellular mobilization of calcium ions. Among other things, CCL2/CCR2 can regulate cell adhesion and chemotaxis of macrophages by activating the β1 integrin and p38-MAPK signaling pathways. In addition to acting as a chemoattractant, CCL2 can also regulate brain endothelial permeability in vitro by altering tight junction (TJ) proteins and regulating the expression of endothelial adhesion molecules and leukocyte integrins as well as cytokine production. In addition, the CCL2-CCR2 signaling axis has been implicated in many inflammatory and neurodegenerative diseases, acting to recruit inflammatory cells into the CNS[2].  Originally described as a "tumor-derived chemokine", CCL2 has been shown to be a potent chemokine for many types of immune cells and a potential target for the treatment of many diseases, such as atherosclerosis, multiple sclerosis, asthma, neuropathic pain, diabetic nephropathy, and cancer[3].

    In Vitro

    MCP-1/CCL2 (100 ng/mL, 24 h) can induce NO production by co-treatment with IFN-γ, increases ERK phosphorylation and increases iNOS expression, suggesting that the mechanism of NO production is related to the ERK1/2 signaling pathway in peritoneal macrophages of mice, thereby increasing bacterial clearance[3].
    CCL2 (0.05 ng/μL) promotes α-synuclein secretion and α-synuclein-induced neuronal apoptosis, and induces microglia proliferation and secretion of TNF-α, IL-1β and NO[4].

    In Vivo

    MCP-1/CCL2 (intracerebral injection, 5-25 μg, 1 μL/h for 3 days or 0.5 μL/h for 7 days) induces FITC-albumin leakage at lower concentrations (5-20 μg) but fails or moderately induces leukocyte infiltration. Blood-brain barrier permeability and leukocyte infiltration are significantly increased at 25 μg, and extravasation is significantly enhanced in the treated CD-1 mice compared with the control group 6 h after injection. Prolonged administration for 3 or 7 days results in a significant increase in the percentage of brain water content, and decreases expression of the tight junction proteins occludin, claudin-5, ZO-1 and ZO-2[2].

    Actividad biológica

    Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is ≤9.804 ng/mL, corresponding to a specific activity is ≥1.02×105 U/mg.

    • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 7.042 ng/mL, corresponding to a specific activity is 1.42×105 U/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P10148 (Q24-R96)

    Gene ID
    Molecular Construction
    N-term
    CCL2 (Q24-R96)
    Accession # P10148
    C-term
    Protein Length

    Partial

    Synonyms
    rMuCCL2; C-C motif chemokine 2; Monocyte chemoattractant protein 1; Monocyte chemotactic protein 1; MCP-1; Ccl2; Scya2
    AA Sequence

    QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

    Predicted Molecular Mass
    8.5 kDa
    Peso molecular

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias

    MCP-1/CCL2 Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    MCP-1/CCL2 Protein, Mouse

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    MCP-1/CCL2 Protein, Mouse
    Cat. No.:
    HY-P7764
    Cantidad:
    MCE Japan Authorized Agent: