Copy Link Print Information

MCP-1/CCL2 Protein, Mouse

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • MCP-1/CCL2 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil[1].

Background

CCL2, also known as monocyte chemotactic protein 1 (MCP1), is a small cell factor belonging to the CC chemokine family. The CCL2 gene, located in the q11.2-q12 region of human chromosome 17, encodes a monomeric polypeptide with a molecular weight of 9-15 kDa, depending on the level of glycosylation. CCL2 is mainly secreted by monocytes, macrophages and dendritic cells. It is secreted by monocytes, macrophages and dendritic cells, and platelet-derived growth factor is the main inducer of the CCL2 gene. Astrocytes and microglia are also thought to be the source of CCL2[1]. CCL2 signals through binding to and activation of CCR2 and induces a strong chemotactic response and intracellular mobilization of calcium ions. Among other things, CCL2/CCR2 can regulate cell adhesion and chemotaxis of macrophages by activating the β1 integrin and p38-MAPK signaling pathways. In addition to acting as a chemoattractant, CCL2 can also regulate brain endothelial permeability in vitro by altering tight junction (TJ) proteins and regulating the expression of endothelial adhesion molecules and leukocyte integrins as well as cytokine production. In addition, the CCL2-CCR2 signaling axis has been implicated in many inflammatory and neurodegenerative diseases, acting to recruit inflammatory cells into the CNS[2].  Originally described as a "tumor-derived chemokine", CCL2 has been shown to be a potent chemokine for many types of immune cells and a potential target for the treatment of many diseases, such as atherosclerosis, multiple sclerosis, asthma, neuropathic pain, diabetic nephropathy, and cancer[3].

In Vitro

MCP-1/CCL2 (100 ng/mL, 24 h) can induce NO production by co-treatment with IFN-γ, increases ERK phosphorylation and increases iNOS expression, suggesting that the mechanism of NO production is related to the ERK1/2 signaling pathway in peritoneal macrophages of mice, thereby increasing bacterial clearance[3].
CCL2 (0.05 ng/μL) promotes α-synuclein secretion and α-synuclein-induced neuronal apoptosis, and induces microglia proliferation and secretion of TNF-α, IL-1β and NO[4].

In Vivo

MCP-1/CCL2 (intracerebral injection, 5-25 μg, 1 μL/h for 3 days or 0.5 μL/h for 7 days) induces FITC-albumin leakage at lower concentrations (5-20 μg) but fails or moderately induces leukocyte infiltration. Blood-brain barrier permeability and leukocyte infiltration are significantly increased at 25 μg, and extravasation is significantly enhanced in the treated CD-1 mice compared with the control group 6 h after injection. Prolonged administration for 3 or 7 days results in a significant increase in the percentage of brain water content, and decreases expression of the tight junction proteins occludin, claudin-5, ZO-1 and ZO-2[2].

Verified Bioactivity

Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is ≤9.804 ng/mL, corresponding to a specific activity is ≥1.02×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P10148 (Q24-R96)

  • Gene ID
    20296  [NCBI]
  • Molecular Construction
    • N-term
    • CCL2 (Q24-R96)
      Accession # P10148
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CCL2; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 2; Prev. SCYA2; Chemokine (C-C Motif) Ligand 2; MCP-1; Monocyte Chemotactic Protein 1; MCP1; Small-Inducible Cytokine A2; MCAF; C-C Motif Chemokine 2; HC11; MGC9434; Monocyte Chemotactic And Act

  • AA Sequence

    QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR

  • Predicted Molecular Mass

    8.5 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Qiongyu Hao, et al.  CCL2/CCR2 signaling in cancer pathogenesis. Cell Commun Signal. 2020 May 29;18(1):82. [Content Brief]

[2]. Martha Gschwandtner, et al. More Than Just Attractive: How CCL2 Influences Myeloid Cell Behavior Beyond Chemotaxis. Front Immunol. 2019 Dec 13;10:2759. [Content Brief]

[3]. Svetlana M Stamatovic, et al. Monocyte chemoattractant protein-1 regulation of blood-brain barrier permeability. J Cereb Blood Flow Metab. 2005 May;25(5):593-606. [Content Brief]

[4]. Rachel N Gomes, et al. Bacterial clearance in septic mice is modulated by MCP-1/CCL2 and nitric oxide. Shock. 2013 Jan;39(1):63-9. [Content Brief]

[5]. Lijun Zhang, et al. Effect of chemokine CC ligand 2 (CCL2) on α?synuclein?induced microglia proliferation and neuronal apoptosis. Mol Med Rep. 2018 Nov;18(5):4213-4218. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 7.042 ng/mL, corresponding to a specific activity is 1.42×105 U/mg.

  • 1/16

    MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753. [Abstract]

    Customer Validation
     Representative photomicrographs of the migratory wild-type BMDMs (stained with crystal violet) following treatment MSC with MCP-1/CCL2 Protein (200 ng/mL), IL-17B (200 ng/mL) or PBS (control) for 24 h in 24-well transwell lower chambers. The number of migratory cells was determined.

  • 1/16

    MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753. [Abstract]

    Customer Validation
     SNs of II17b-/- mice were injected with recombinant MCP-1/CCL2 Protein (1 mg/nerve) and then subjected to crush injury for 3 days. MCP-1/CCL2 Protein can effectively restore macrophage recruitment in II17b-/- mice.

  • 1/16

    MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biomolecules. 2024 Sep 3;14(9):1109. [Abstract]

    Customer Validation
     Spiking healthy control plasma with MCP-1/CCL2 Protein (5 μg/mL), followed by microcontact printing and detection via immunofluorescence, clearly revealed MCP-1/CCL2 Protein-specific microcontact-printed lanes compared to the control without MCP-1/CCL2 Protein in the plasma.

  • 1/16

    MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114. [Abstract]

    Customer Validation
     Oil Red O staining of the adipogenic potential of 2-week-old ASCs cultured with differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) was performed. MCP-1/CCL2 Protein significantly promoted the adipogenic differentiation capability of ASCs, resulting in more lipid droplet formation.

  • 1/16

    MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114. [Abstract]

    Customer Validation
     Protein levels of p-AKT, AKT, and β-catenin in ASCs cultured in adipogenic differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) were measured by western blot. MCP-1/CCL2 Protein significantly increased the expression level of p-AKT and decreased the expression level of β-catenin.

  • MCP-1/CCL2 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • Experimental Validation Results for MCP-1/CCL2 Protein, Mouse
  • MCP-1/CCL2 Protein, Mouse Product Image

  • MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753. [Abstract]

    Representative photomicrographs of the migratory wild-type BMDMs (stained with crystal violet) following treatment MSC with MCP-1/CCL2 Protein (200 ng/mL), IL-17B (200 ng/mL) or PBS (control) for 24 h in 24-well transwell lower chambers. The number of migratory cells was determined.

  • MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2024 Feb 27;43(2):113753. [Abstract]

    SNs of II17b-/- mice were injected with recombinant MCP-1/CCL2 Protein (1 mg/nerve) and then subjected to crush injury for 3 days. MCP-1/CCL2 Protein can effectively restore macrophage recruitment in II17b-/- mice.

  • MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Biomolecules. 2024 Sep 3;14(9):1109. [Abstract]

    Spiking healthy control plasma with MCP-1/CCL2 Protein (5 μg/mL), followed by microcontact printing and detection via immunofluorescence, clearly revealed MCP-1/CCL2 Protein-specific microcontact-printed lanes compared to the control without MCP-1/CCL2 Protein in the plasma.

  • MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114. [Abstract]

    Oil Red O staining of the adipogenic potential of 2-week-old ASCs cultured with differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) was performed. MCP-1/CCL2 Protein significantly promoted the adipogenic differentiation capability of ASCs, resulting in more lipid droplet formation.

  • MCP-1/CCL2 Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2023 Aug;37(8):e23114. [Abstract]

    Protein levels of p-AKT, AKT, and β-catenin in ASCs cultured in adipogenic differentiation medium with or without MCP-1/CCL2 Protein (100 ng/mL; 8 d) were measured by western blot. MCP-1/CCL2 Protein significantly increased the expression level of p-AKT and decreased the expression level of β-catenin.