[Des-His1,Glu9]-Glucagon amide
Based on 1 Customer Validation
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes.
For research use only. We do not sell to patients.
- Purity: 99.32%
- CAS No.: 110084-95-2
- Formula: C148H221N41O47S
- Molecular Weight:3358.65
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
![[Des-His1,Glu9]-Glucagon amide Chemical Structure](https://file.medchemexpress.com/product_pic/hy-p1143.gif "Click to View [Des-His1,Glu9]-Glucagon amide Chemical Structure")
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
-
HY-13443
Exendin-4
-
HY-P0264
Exendin(9-39) amide
-
HY-50663
MK 0893
-
HY-P1024
GLP-2(1-33)(human)
-
HY-P1141
GLP-1(9-36)amide
-
HY-103547
L-168049
-
HY-P1144
Oxyntomodulin (bovine, porcine)
-
HY-50158
Glucagon receptor antagonist-2
-
HY-P1145
Glucagon-like peptide 1 (1-37), human
-
HY-50159
Glucagon receptor antagonist-3
-
HY-P1142
GLP-2(rat)
-
HY-P0054A
GLP-1(7-36), amide
Biological Activity
glucagon receptor[1]
Chemical Information
-
CAS No. 110084-95-2
-
Appearance Solid
-
Molecular Weight 3358.65
-
Formula C148H221N41O47S
-
Color White to off-white
-
Sequence
Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2
-
Sequence Shortening
SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : ≥ 10 mg/mL (2.98 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (278 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2977 mL | 1.4887 mL | 2.9774 mL | 7.4435 mL |
[Des-His1,Glu9]-Glucagon amide Related Classifications
HY-P1143 Related Classifications
Powered by Bioz