1. GPCR/G Protein
  2. Glucagon Receptor
  3. GLP-2(3-33)

GLP-2(3-33) 

Cat. No.: HY-P2625
Handling Instructions

GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-2(3-33) Chemical Structure

GLP-2(3-33) Chemical Structure

CAS No. : 275801-62-2

Size Price Stock
1 mg USD 280 Ask For Quote & Lead Time
5 mg USD 850 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM)[1][2].

In Vitro

GLP-2 is secreted as a 33-amino acid peptide, but is rapidly degraded at an N-terminus site to GLP-2(3-33) in circulation, in large part, by dipeptidylpeptidase IV (DPPIV). GLP-2 (3-33) acts as a partial agonist with potential competitive antagonistic properties on the GLP-2 receptor. In the GLP-2 receptor-binding assay, the binding IC50 for GLP-2 1–33 was 3.1 nM, and it was 41 nM for GLP-2 3-33. Thus, GLP-2 3–33 had 7.5% binding affinity compared to GLP-2 1-33[1].

In Vivo

GLP-2(3-33) (60 ng; once a day i.p. for 4 weeks) increases dyslipidemia and hepatic lipid accumulation in HFD-fed mice[2].

Animal Model: Male C57BL/6J (B6) mice (HFD)[2]
Dosage: 60 ng
Administration: Once a day i.p. for 4 weeks
Result: Significantly affected plasma lipids; Showed increase of triglycerides and cholesterol and reduction of HDL; Significantly increased plasma ALT and AST and intrahepatic lipid concentration.
Molecular Weight

3557.89

Formula

C₁₅₆H₂₄₂N₄₀O₅₃S

CAS No.

275801-62-2

Sequence Shortening

DGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

GLP-2(3-33)Glucagon ReceptorGCGRDPPIVHFD-fedcompetitivecirculationInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-2(3-33)
Cat. No.:
HY-P2625
Quantity:
MCE Japan Authorized Agent: