1. Membrane Transporter/Ion Channel
  2. Potassium Channel
  3. Guangxitoxin 1E

Guangxitoxin 1E 

Cat. No.: HY-P1427
Handling Instructions

Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Guangxitoxin 1E Chemical Structure

Guangxitoxin 1E Chemical Structure

CAS No. : 1233152-82-3

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons[1][2].

IC50 & Target

IC50: 1-3 nM (KV2 channels); 24-54 nM (KV4.3 channels)[2]

In Vitro

Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM but has no significant effect on KV1.2, KV1.3, KV1.5, KV3.2 and BK potassium channels, nor on calcium and sodium channels CaV1.2, CaV2.2, NaV1.5, NaV1.7, NaV1.8, whereas the IC50 for KV4.3 channels is 24-54 nM[2].
In mouse β-cells, Guangxitoxin 1E inhibits 90% of IDR and, as for KV2.1, shifts the voltage dependence of channel activation to more depolarized potentials, a characteristic of gating-modifier peptides. Guangxitoxin 1E broadens theβ-cell action potential, enhances glucose-stimulated intracellular calcium oscillations, and enhances insulin secretion from mouse pancreatic islets in a glucose-dependent manner[2].

Molecular Weight

3948.61

Formula

C₁₇₈H₂₄₈N₄₄O₄₅S₇

CAS No.

1233152-82-3

Sequence

{Glu}{Gly}{Glu}{Cys}{Gly}{Gly}{Phe}{Trp}{Trp}{Lys}{Cys}{Gly}{Ser}{Gly}{Lys}{Pro}{Ala}{Cys}{Cys}{Pro}(Disulfide bridge: Cys4-Cys19; Cys11-Cys24; Cys18-Cys31)

Sequence Shortening

EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP(Disulfide bridge:Cys4-Cys19;Cys11-Cys24;Cys18-Cys31)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Guangxitoxin 1EPotassium ChannelKcsAInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Guangxitoxin 1E
Cat. No.:
HY-P1427
Quantity:
MCE Japan Authorized Agent: