1. Membrane Transporter/Ion Channel
    Neuronal Signaling
  2. Calcium Channel
  3. Huwentoxin XVI TFA

Huwentoxin XVI TFA 

Cat. No.: HY-P1078A
Handling Instructions

Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Huwentoxin XVI TFA Chemical Structure

Huwentoxin XVI TFA Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Huwentoxin XVI TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels[1].

IC50 & Target

IC50: ~60 nM (N-type calcium channel)[1]

Molecular Weight

4551.15

Formula

C₁₉₈H₂₉₃F₃N₅₀O₅₈S₆

Sequence

Cys-Ile-Gly-Glu-Gly-Val-Pro-Cys-Asp-Glu-Asn-Asp-Pro-Arg-Cys-Cys-Ser-Gly-Leu-Val-Cys-Leu-Lys-Pro-Thr-Leu-His-Gly-Ile-Trp-Tyr-Lys-Ser-Tyr-Tyr-Cys-Tyr-Lys-Lys (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36)

Sequence Shortening

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Huwentoxin XVICalcium ChannelCa2+ channelsCa channelsNeurotoxinanalgesicN-typemammalianpolypeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Huwentoxin XVI TFA
Cat. No.:
HY-P1078A
Quantity:
MCE Japan Authorized Agent: