1. Metabolic Enzyme/Protease
  2. Angiotensin-converting Enzyme (ACE)


Cat. No.: HY-P3142
Handling Instructions

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

For research use only. We do not sell to patients.

Custom Peptide Synthesis



Size Price Stock Quantity
5 mg USD 820 In-stock
Estimated Time of Arrival: December 31
10 mg USD 1425 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review


NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

Molecular Weight




Sequence Shortening



Room temperature in continental US; may vary elsewhere.

Powder -80°C 2 years
-20°C 1 year
In solvent -80°C 6 months
-20°C 1 month
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2


NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQAngiotensin-converting Enzyme (ACE)ACE2relatedpeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name



Applicant Name *


Email address *

Phone number *


Organization name *

Department *


Requested quantity *

Country or Region *



Bulk Inquiry

Inquiry Information

Product Name:
Cat. No.:
MCE Japan Authorized Agent: