country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P2710

Copy Link Print Information

Noxiustoxin

Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC₅₀ = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease.

For research use only. We do not sell to patients.

CAS No.: 85205-49-8
Formula: C₁₇₄H₂₈₆N₅₂O₅₄S₇
Molecular Weight:4195.00

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Noxiustoxin Chemical Structure

CAS No.: 85205-49-8

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

CAS No. 85205-49-8
Molecular Weight 4195.00
Formula C₁₇₄H₂₈₆N₅₂O₅₄S₇
Sequence

Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Ser-Lys-Pro-Cys-Lys-Glu-Leu-Tyr-Gly-Ser-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Asn-Asn-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
Sequence Shortening

TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2 (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Protocols

All Cell Biology

Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (260 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. M Dauplais, et al. Determination of the Three-Dimensional Solution Structure of Noxiustoxin: Analysis of Structural Differences with Related Short-Chain Scorpion Toxins. Biochemistry.1995 Dec 26;34(51):16563-73. [Content Brief]

[2]. H H Valdivia, et al. Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+(Ca2+) channel. FEBS Lett. 1988 Jan 4;226(2):280-4. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote