Oxyntomodulin (human, mouse, rat)
Based on 1 Customer Validation
Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids.
For research use only. We do not sell to patients.
- Purity : 99.69%
- CAS No.: 159002-68-3
- Formula: C192H295N61O60S
- Molecular Weight:4449.83
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
Chemical Information
-
CAS No. 159002-68-3
-
Appearance Solid
-
Molecular Weight 4449.83
-
Formula C192H295N61O60S
-
Color White to off-white
-
Synonyms
Proglucagon (33-69)
-
Sequence
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala
-
Sequence Shortening
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (22.47 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (267 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2247 mL | 1.1236 mL | 2.2473 mL | 5.6182 mL |
| 5 mM | 0.0449 mL | 0.2247 mL | 0.4495 mL | 1.1236 mL | |
| 10 mM | 0.0225 mL | 0.1124 mL | 0.2247 mL | 0.5618 mL | |
| 15 mM | 0.0150 mL | 0.0749 mL | 0.1498 mL | 0.3745 mL | |
| 20 mM | 0.0112 mL | 0.0562 mL | 0.1124 mL | 0.2809 mL |