14-3-3 theta Protein, Mouse (sf9, His)

14-3-3 theta Protein, Mouse (sf9, His) is the recombinant mouse-derived 14-3-3 theta protein, expressed by Sf9 insect cells, with His tag.

The 14-3-3 theta protein functions as an adapter implicated in the regulation of a diverse array of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs. This binding typically results in the modulation of the activity of the interacting partner. Notably, 14-3-3 theta negatively regulates the kinase activity of PDPK1 and forms homodimers. It interacts with CDK16, RGS7 in its phosphorylated form, SSH1, CDKN1B in its 'Thr-198' phosphorylated form, GAB2, the 'Ser-241' phosphorylated form of PDPK1, and the 'Thr-369' phosphorylated form of DAPK2. Additionally, 14-3-3 theta interacts with PI4KB, TBC1D22A, TBC1D22B, SLITRK1, RIPOR2 isoform 2, INAVA (increasing upon pattern recognition receptor stimulation), MARK2, MARK3, MARK4, and MEFV. These interactions underscore the versatile role of 14-3-3 theta in various cellular processes and signaling pathways.

Mouse

Sf9 insect cells

His

P68254-1 (M1-N245)

22630

Full Length of Isoform-1

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

≥ 90%, as determined by reducing SDS-PAGE.