1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc)

4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc)

Cat. No.: HY-P704337
Handling Instructions Technical Support

4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc) is the recombinant human-derived 4-1BB/TNFRSF9 protein, expressed by HEK293, with C-hFc tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc) is the recombinant human-derived 4-1BB/TNFRSF9 protein, expressed by HEK293, with C-hFc tag.

Background

4-1BB, encoded by TNFRSF9 (CD137, ILA), belongs to the tumor necrosis factor (TNF) receptor superfamily. 4-1BB is a surface glycoprotein expressed in a variety of cells, such as T cells, B cells, natural killer (NK) cells, dendritic cells (DCs), eosinophils and mast cells; and even a variety of tumor cells such as human leukemia cells. It is widely distributed in vascular smooth muscle, tumor vascular walls and liver tissue of hepatocellular carcinoma. 4-1BB preferentially selects CD8+ cells rather than CD4+ cells. It provides co-stimulatory signals and activates the cytotoxic effect of CD8+ T cells and contributes to the formation of memory T cells. Finally, it promotes the immune system to fight tumors. In addition, CD137 binds CD137L to signal monocytes, increasing their survival, proliferation and stimulating their migration and extravasation. In addition, it induces the release of multiple proinflammatory factors, leading to the influx of inflammatory monocytes into tissues and forming an inflammatory environment . Specifically, CD137 promotes the migration of monocytes/macrophages into the tumor microenvironment by upregulating the expression of Fra1. It also promotes the differentiation of monocytes/macrophages into osteoclasts, thereby providing a favorable microenvironment for breast cancer cells to colonize and grow in the bone. It provides a promising therapeutic strategy for breast cancer metastasis . In addition, CD137 signaling promotes endothelial cell (EC) apoptosis through pro-oxidative and pro-inflammatory mechanisms mediated by the Nrf2 and NF-κB pathways, respectively . The 4-1BB protein has low homology in humans and mice, with a sequence similarity of 56.75%.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q07011 (D87-Q186)

Gene ID

3604

Molecular Construction
N-term
4-1BB (D87-Q186)
Accession # Q07011
hFc
C-term
Protein Length

Partial

Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
AA Sequence

DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Predicted Molecular Mass
37.1 kDa
Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Human (100a,a, HEK293, Fc)
Cat. No.:
HY-P704337
Quantity:
MCE Japan Authorized Agent: