1. Recombinant Proteins
  2. Others
  3. 5HT2A Protein, Human (S162K, M164W, sf9, Flag, His)

5HT2A Protein, Human (S162K, M164W, sf9, Flag, His)

Cat. No.: HY-P703149
Handling Instructions Technical Support

5HT2A Protein, Human (S162K, M164W, sf9, Flag, His) is the recombinant human-derived 5HT2A, expressed by sf9 insect cells, with His, Flag labeled tag.,

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

5HT2A Protein, Human (S162K, M164W, sf9, Flag, His) is the recombinant human-derived 5HT2A, expressed by sf9 insect cells, with His, Flag labeled tag.,

Background

5HT2A is a G-protein coupled receptor primarily activated by 5-hydroxytryptamine (serotonin) and also serves as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, DOI, and LSD. Ligand binding triggers signaling via G(q)/G(11) G alpha proteins, activating phospholipase C-beta to release second messengers DAG and IP3, which modulate phosphatidylinositol 3-kinase activity and promote intracellular calcium release. Beta-arrestin family members inhibit G protein signaling while mediating alternative pathway activation. 5HT2A influences neural activity, perception, cognition, and mood, and plays a role in behavioral regulation (e.g., anxiety responses and psychoactive substance reactions). Additionally, it is involved in intestinal smooth muscle contraction (by similarity) and may contribute to arterial vasoconstriction (by similarity).

Species

Human

Source

Sf9 insect cells

Tag

His;Flag

Accession

P28223-1 (H70-A265, S162K, M164W, Q313-K403)

Gene ID

3356

Protein Length

Partial

Synonyms
HTR2; HTR2A; Serotonin receptor 2A
AA Sequence

QSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENK

Predicted Molecular Mass
45.5 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.01%, w/v LMNG, 0.001%, w/v CHS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

5HT2A Protein, Human (S162K, M164W, sf9, Flag, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

5HT2A Protein, Human (S162K, M164W, sf9, Flag, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
5HT2A Protein, Human (S162K, M164W, sf9, Flag, His)
Cat. No.:
HY-P703149
수량:
MCE Japan Authorized Agent: