1. Recombinant Proteins
  2. Others
  3. 5HT2A Protein, Human (L247A, L371A, sf9, Flag, His)

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His)

Cat. No.: HY-P703150
Handling Instructions Technical Support

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His) is the recombinant human-derived 5HT2A, expressed by sf9 insect cells, with His, Flag labeled tag.,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His) is the recombinant human-derived 5HT2A, expressed by sf9 insect cells, with His, Flag labeled tag.,

Background

5HT2A is a G-protein coupled receptor primarily activated by 5-hydroxytryptamine (serotonin) and also serves as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, DOI, and LSD. Ligand binding triggers signaling via G(q)/G(11) G alpha proteins, activating phospholipase C-beta to release second messengers DAG and IP3, which modulate phosphatidylinositol 3-kinase activity and promote intracellular calcium release. Beta-arrestin family members inhibit G protein signaling while mediating alternative pathway activation. 5HT2A influences neural activity, perception, cognition, and mood, and plays a role in behavioral regulation (e.g., anxiety responses and psychoactive substance reactions). Additionally, it is involved in intestinal smooth muscle contraction (by similarity) and may contribute to arterial vasoconstriction (by similarity).

Species

Human

Source

Sf9 insect cells

Tag

His;Flag

Accession

P28223-1 (L66-A265, T311-P405, L247A, L371A)

Gene ID

3356

Protein Length

Partial

Synonyms
HTR2; HTR2A; Serotonin receptor 2A
AA Sequence

TMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYASSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKP

Predicted Molecular Mass
48.3 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
5HT2A Protein, Human (L247A, L371A, sf9, Flag, His)
Cat. No.:
HY-P703150
Quantity:
MCE Japan Authorized Agent: