5HT2A Protein, Human (L247A, L371A, sf9, Flag, His)

5HT2A Protein, Human (L247A, L371A, sf9, Flag, His) is the recombinant human-derived 5HT2A, expressed by sf9 insect cells, with His, Flag labeled tag.,

5HT2A is a G-protein coupled receptor primarily activated by 5-hydroxytryptamine (serotonin) and also serves as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, DOI, and LSD. Ligand binding triggers signaling via G(q)/G(11) G alpha proteins, activating phospholipase C-beta to release second messengers DAG and IP3, which modulate phosphatidylinositol 3-kinase activity and promote intracellular calcium release. Beta-arrestin family members inhibit G protein signaling while mediating alternative pathway activation. 5HT2A influences neural activity, perception, cognition, and mood, and plays a role in behavioral regulation (e.g., anxiety responses and psychoactive substance reactions). Additionally, it is involved in intestinal smooth muscle contraction (by similarity) and may contribute to arterial vasoconstriction (by similarity).

Human

Sf9 insect cells

His;Flag

P28223-1 (L66-A265, T311-P405, L247A, L371A)

3356

Partial

TMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYASSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKP

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.