ACLY Protein, Human (His-SUMO)
Based on 1 publication(s) in Google Scholar
ACLY Protein, Human (His-SUMO) is an important enzyme in the cholesterol biosynthetic pathway. ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ACLY Protein, Human (His-SUMO) is an important enzyme in the cholesterol biosynthetic pathway. ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis.
Background
ATP citrate lyase (ACLY) is an important enzyme linking carbohydrate to lipid metabolism by generating acetyl-CoA from citrate for fatty acid and cholesterol biosynthesis. ACLY is an important enzyme in the cholesterol biosynthetic pathway upstream of the 3-hydroxy3-methylglutaryl coenzyme A reductase (HMGCR) (which is targeted by statins). ACLY produces acetyl-CoA (AcCoA) from mitochondrial citrate for cholesterol and fatty acid biosynthesis. ACLY forms homotetramers through the C-terminus (citrate synthase homeodomain) to promote ACLY binding to CoA and AcCoA production[1].
Verified Bioactivity
No Enzyme activity.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int Immunopharmacol
RNF180 suppressed aggressiveness by degrading NOTCH1, TRIM24 and FOXC1, and chemoresistance by degrading ACC1 and ACLY in colorectal cancer. [Abstract]2025 Sep 6:165:115445. PMID: 40915184
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P53396 (K4-K265)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
ACLY (K4-K265)
Accession # P53396 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ACLY; ATP-Citrate (Pro-S-)-Lyase; ATP Citrate Lyase; Citrate Cleavage Enzyme; ACL; ATP-Citrate Synthase; ATPCL; ATP Citrate Synthase; CLATP
-
AA Sequence
KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK
-
Predicted Molecular Mass
45.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)