2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3) ADAMs/ADAMTSs
  5. ADAM15
  6. ADAM15 Protein, Human (CHO, His)

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (CHO, His) is the recombinant human-derived ADAM15 protein, expressed by CHO , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (CHO, His) is the recombinant human-derived ADAM15 protein, expressed by CHO , with C-His labeled tag.
Background

ADAM15 protein is an active metalloproteinase that possesses gelatinolytic and collagenolytic activity. It is involved in various biological processes, including wound healing, heterotypic intraepithelial cell/T-cell interactions, and homotypic T-cell aggregation. ADAM15 also inhibits the adhesion and migration of airway smooth muscle cells mediated by beta-1 integrin. It suppresses cell motility towards fibronectin, potentially by reducing the expression of alpha-v/beta-1 integrin through the inactivation of ERK1/2. Additionally, ADAM15 cleaves E-cadherin in response to growth factor deprivation and plays a role in glomerular cell migration and pathological neovascularization. It may also have a role in cartilage remodeling. During sperm epididymal maturation and the acrosome reaction, ADAM15 may undergo proteolytic processing. Its disintegrin domain suggests a potential involvement in sperm-egg binding.
Species

Human
Source

CHO

Tag

C-His
Accession

Q13444 (D207-T696)
Gene ID
Molecular Construction
N-term
ADAM15 (D207-T696)
Accession # Q13444
His
C-term
Protein Length

Extracellular Domain
Synonyms
Disintegrin and metalloproteinase domain-containing protein 15; ADAM 15; MDC-15; Metargidin
AA Sequence

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT

Predicted Molecular Mass
54 kDa
Peso molecular

Approximately 65-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.
Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentación
Instrucciones de manejo (2659 KB)
Referencias

ADAM15 Protein, Human (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

ADAM15 Protein, Human (CHO, His)

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
ADAM15 Protein, Human (CHO, His)
Cat. No.:
HY-P75534
Cantidad:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Country or Region *

Direcciòn del E-mail *

     

Número de teléfono *

 

Nombre de la Organizaciòn *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.