AHSP Protein, Human

AHSP proteins are chaperones in developing red blood cells that protect alpha-hemoglobin from harmful aggregation and precipitation. It is essential for alpha-hemoglobin stability, and it regulates conditions associated with excess alpha-hemoglobin, such as beta-thalassemia. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli , with tag free.

AHSP protein serves as a chaperone during normal erythroid cell development, safeguarding alpha-hemoglobin from harmful aggregation by preventing its precipitation. This protective function is crucial for maintaining the stability of free alpha-hemoglobin and is particularly relevant in modulating pathological conditions associated with an excess of alpha-hemoglobin, such as beta-thalassemia. AHSP exists as a monomer and forms a specific heterodimeric complex with free alpha-hemoglobin, exhibiting selectivity as it does not bind to beta-hemoglobin or the alpha(2)beta(2) hemoglobin A complex. This interaction underscores AHSP's role in preventing detrimental interactions and maintaining the proper balance of hemoglobin components during erythropoiesis.

Human

E. coli

Tag Free

Q9NZD4 (M1-S102)

51327  [NCBI]

Full Length

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Approximately 12 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.