AHSP Protein, Human
Based on 1 Customer Validation
AHSP proteins are chaperones in developing red blood cells that protect alpha-hemoglobin from harmful aggregation and precipitation. It is essential for alpha-hemoglobin stability, and it regulates conditions associated with excess alpha-hemoglobin, such as beta-thalassemia. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
AHSP proteins are chaperones in developing red blood cells that protect alpha-hemoglobin from harmful aggregation and precipitation. It is essential for alpha-hemoglobin stability, and it regulates conditions associated with excess alpha-hemoglobin, such as beta-thalassemia. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli , with tag free.
Background
AHSP protein serves as a chaperone during normal erythroid cell development, safeguarding alpha-hemoglobin from harmful aggregation by preventing its precipitation. This protective function is crucial for maintaining the stability of free alpha-hemoglobin and is particularly relevant in modulating pathological conditions associated with an excess of alpha-hemoglobin, such as beta-thalassemia. AHSP exists as a monomer and forms a specific heterodimeric complex with free alpha-hemoglobin, exhibiting selectivity as it does not bind to beta-hemoglobin or the alpha(2)beta(2) hemoglobin A complex. This interaction underscores AHSP's role in preventing detrimental interactions and maintaining the proper balance of hemoglobin components during erythropoiesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NZD4 (M1-S102)
-
Molecular Construction
-
N-term
-
AHSP (M1-S102)
Accession # Q9NZD4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AHSP; Alpha-Hemoglobin-Stabilizing Protein; Prev. ERAF; Erythroid-Associated Factor; EDRF; Erythroid Differentiation Associated Factor; Erythroid Differentiation-Related Factor; Erythroid Associated Factor; Alpha Hemoglobin Stabilizing Protein; Alpha Hemo
-
AA Sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)