1. Recombinant Proteins
  2. Others
  3. AHSP Protein, Human

AHSP Protein, Human

Cat. No.: HY-P76136
COA Handling Instructions

AHSP protein, a chaperone in erythroid cell development, safeguards alpha-hemoglobin, preventing harmful aggregation and precipitation. Crucial for alpha-hemoglobin stability, it modulates conditions linked to alpha-hemoglobin excess, like beta-thalassemia. AHSP forms a selective heterodimer with free alpha-hemoglobin, not binding to beta-hemoglobin or alpha(2)beta(2) hemoglobin A. This interaction prevents detrimental interactions, ensuring the proper hemoglobin component balance in erythropoiesis. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli, with tag free. The total length of AHSP Protein, Human is 102 a.a., with molecular weight of ~12 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $230 In-stock
100 μg $390 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AHSP protein, a chaperone in erythroid cell development, safeguards alpha-hemoglobin, preventing harmful aggregation and precipitation. Crucial for alpha-hemoglobin stability, it modulates conditions linked to alpha-hemoglobin excess, like beta-thalassemia. AHSP forms a selective heterodimer with free alpha-hemoglobin, not binding to beta-hemoglobin or alpha(2)beta(2) hemoglobin A. This interaction prevents detrimental interactions, ensuring the proper hemoglobin component balance in erythropoiesis. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli, with tag free. The total length of AHSP Protein, Human is 102 a.a., with molecular weight of ~12 KDa.

Background

AHSP protein serves as a chaperone during normal erythroid cell development, safeguarding alpha-hemoglobin from harmful aggregation by preventing its precipitation. This protective function is crucial for maintaining the stability of free alpha-hemoglobin and is particularly relevant in modulating pathological conditions associated with an excess of alpha-hemoglobin, such as beta-thalassemia. AHSP exists as a monomer and forms a specific heterodimeric complex with free alpha-hemoglobin, exhibiting selectivity as it does not bind to beta-hemoglobin or the alpha(2)beta(2) hemoglobin A complex. This interaction underscores AHSP's role in preventing detrimental interactions and maintaining the proper balance of hemoglobin components during erythropoiesis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NZD4 (M1-S102)

Gene ID
Molecular Construction
N-term
AHSP (M1-S102)
Accession # Q9NZD4
C-term
Synonyms
Alpha-hemoglobin-stabilizing protein; Erythroid-associated factor; AHSP; EDRF; ERAF
AA Sequence

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AHSP Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AHSP Protein, Human
Cat. No.:
HY-P76136
Quantity:
MCE Japan Authorized Agent: