AICDA Protein, Mouse (His-Myc)
Based on 1 Customer Validation
AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.
Background
Activation-induced cytidine deaminase (AICDA), an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells, is required for DLBCL pathogenesis and linked to inferior outcome. AICDA overexpression causes more aggressive disease in BCL2-driven murine lymphomas. Besides the role of AICDA in modifying cytosine methylation during the GC reaction13, AICDA is additionally a critical source of epigenetic heterogeneity in DLBCL. AICDA-linked epigenetic heterogeneity is predominantly associated with relative loss of cytosine methylation, consistent with the known mechanism of action of AICDA in cytosine deamination. AICDA-induced epigenetic heterogeneity increases plasticity, permitting cancer cells a greater degree of population diversity and enhancing the adaptive capacity of the overall tumor[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q9WVE0 (M1-F198)
-
Molecular Construction
-
N-term
-
10*His
-
AICDA (M1-F198)
Accession # Q9WVE0 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AICDA; CDA2; Activation Induced Cytidine Deaminase; ARP2; AID; HEL-S-284; Single-Stranded DNA Cytosine Deaminase; Integrated Into Burkitt'S Lymphoma Cell Line Ramos; Activation-Induced Cytidine Deaminase; Epididymis Secretory Protein Li 284; Cytidine Amin
-
AA Sequence
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF
-
Predicted Molecular Mass
31.5 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
