AICDA Protein, Mouse (His-Myc)

Customer Review

Based on 1 Customer Validation

AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.

Background

Activation-induced cytidine deaminase (AICDA), an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells, is required for DLBCL pathogenesis and linked to inferior outcome. AICDA overexpression causes more aggressive disease in BCL2-driven murine lymphomas. Besides the role of AICDA in modifying cytosine methylation during the GC reaction13, AICDA is additionally a critical source of epigenetic heterogeneity in DLBCL. AICDA-linked epigenetic heterogeneity is predominantly associated with relative loss of cytosine methylation, consistent with the known mechanism of action of AICDA in cytosine deamination. AICDA-induced epigenetic heterogeneity increases plasticity, permitting cancer cells a greater degree of population diversity and enhancing the adaptive capacity of the overall tumor[1].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • AICDA (M1-F198)
      Accession # Q9WVE0
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    AICDA; CDA2; Activation Induced Cytidine Deaminase; ARP2; AID; HEL-S-284; Single-Stranded DNA Cytosine Deaminase; Integrated Into Burkitt'S Lymphoma Cell Line Ramos; Activation-Induced Cytidine Deaminase; Epididymis Secretory Protein Li 284; Cytidine Amin

  • AA Sequence

    MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

  • Predicted Molecular Mass

    31.5 kDa

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00