AICDA Protein, Mouse (His-Myc)

AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.

Activation-induced cytidine deaminase (AICDA), an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells, is required for DLBCL pathogenesis and linked to inferior outcome. AICDA overexpression causes more aggressive disease in BCL2-driven murine lymphomas. Besides the role of AICDA in modifying cytosine methylation during the GC reaction13, AICDA is additionally a critical source of epigenetic heterogeneity in DLBCL. AICDA-linked epigenetic heterogeneity is predominantly associated with relative loss of cytosine methylation, consistent with the known mechanism of action of AICDA in cytosine deamination. AICDA-induced epigenetic heterogeneity increases plasticity, permitting cancer cells a greater degree of population diversity and enhancing the adaptive capacity of the overall tumor^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-10*His;C-Myc

Q9WVE0 (M1-F198)

11628  [NCBI]

Full Length

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Teater M, et, al. AICDA drives epigenetic heterogeneity and accelerates germinal center-derived lymphomagenesis. Nat Commun. 2018 Jan 15;9(1):222.  [Content Brief]