AIF1 Protein, Mouse (His)
AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.
Background
Allograft inflammatory factor-1 (AIF-1), which is also known as ionized calcium-binding adapter molecule 1 (Iba1), is a cytoplasmic protein with EF-hand calcium-binding domains and was first observed in the macrophages of rat heart allografts under chronic rejection. AIF-1 is highly expressed in the monocytic lineage, including macrophages and microglia, and is involved in phagocytosis and the formation of membrane ruffling through Rac1, which belongs to the Rho-family of GTPases. AIF-1 is not present in cultured human VSMCs but is induced by cytokines, and overexpression of AIF-1 results in increased VSMC growth and cell-cycle gene expression[1][2].
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
O70200 (S2-P147)
-
Molecular Construction
-
N-term
-
6*His
-
AIF1 (S2-P147)
Accession # O70200 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AIF1; Interferon Gamma Responsive Transcript; Allograft Inflammatory Factor 1; Em:AF129756.17; AIF-1; Protein G1; IBA1; IRT1; Ionized Calcium-Binding Adapter Molecule 1; G1; IRT-1
-
AA Sequence
SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
-
Predicted Molecular Mass
20.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Autieri MV, et, al. AIF-1 is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration. Circ Res. 2003 May 30;92(10):1107-14. [Content Brief]
[2]. Kishikawa S, et, al. Allograft inflammatory factor 1 is a regulator of transcytosis in M cells. Nat Commun. 2017 Feb 22;8:14509. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)