1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ALDH1A1 Protein, Human (His)

ALDH1A1 Protein, Human (His)

Cat. No.: HY-P7474
COA Handling Instructions

ALDH1A1 Protein, Human (His) is a human recombinant ALDH1A1 with an N-terminal Met and His tag produced in E. coli. ALDH1A1 Protein, Human (His) contains 501 amino acids (1-501 a.a.).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ALDH1A1 Protein, Human (His) is a human recombinant ALDH1A1 with an N-terminal Met and His tag produced in E. coli. ALDH1A1 Protein, Human (His) contains 501 amino acids (1-501 a.a.).

Background

Aldehyde Dehydrogenase 1-A1 (ALDH1A1) is part of the aldehyde dehydrogenases family. Human ALDH1A1 is a cytosolic homotetramer expressed in several tissues (skin, eyes, liver, kidney, testis and brain). ALDH1A1oxidizes a broad range of aliphatic and aromatic aldehydes including those formed endogenously such as retinalsand 3,4-dihydroxyphenylacetaldehyde (DOPAL), xenobiotics such as benzaldehyde or those produced during lipid peroxidation[1].

Species

Human

Source

E. coli

Tag

C-His

Accession

P00352 (M1-S501)

Gene ID

216  [NCBI]

Synonyms
rHuAldehyde Dehydrogenase 1-A1, His; ALDH-1A1; Aldehyde Dehydrogenase 1-A1
AA Sequence

HHHHHHMSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

Molecular Weight

Approximately 60.0 kDa

Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

ALDH1A1 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALDH1A1 Protein, Human (His)
Cat. No.:
HY-P7474
Quantity:
MCE Japan Authorized Agent: