1. Recombinant Proteins
  2. Alpha-crystallin B chain/CRYAB Protein, Human (His)

Alpha-crystallin B chain/CRYAB Protein, Human (His)

Cat. No.: HY-P7873
Handling Instructions

Alpha-crystallin B chain/CRYAB Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. CRYAB is an important member of the small heat shock protein family, and plays a protective role in neurological inflammation[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $115 Ask For Quote & Lead Time
50 μg $345 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuAlpha-crystallin B chain/CRYAB, His; Alpha-Crystallin B Chain; Alpha(B)-Crystallin; Heat Shock Protein Beta-5; HspB5; Renal Carcinoma Antigen NY-REN-27; Rosenthal Fiber Component; CRYAB; CRYA2
Species

Human

Source

E. coli

Accession

P02511 (M1-K175)

Gene ID

1410

Molecular Weight

Approximately 25.0 kDa

AA Sequence

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Purity

Greater than 95% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CRYAB regulates inflammatory response in intestinal mucosa by inhibiting IKKβ-mediated signaling and may serve as a novel therapeutic approach in the inflammatory bowel disease (IBD). Enforced expression of CRYAB suppressed expression of proinflammatory cytokines (e.g., TNF-α, IL-6, IL-1β, and IL-8) via inhibiting the IKK complex formation, whereas lack of CRYAB expression markedly enhanced proinflammatory responses[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alpha-crystallin B chain/CRYAB Protein, Human (His)
Cat. No.:
HY-P7873
Quantity:
MCE Japan Authorized Agent: