1. Recombinant Proteins
  2. Receptor Proteins
  3. Receptor Serine/Threonine Kinases
  4. Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
  5. AMHR2/MISRII Protein, Human (HEK293, Fc)

AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293, Fc) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293, Fc) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Upon ligand binding, AMHR2/MISRII Protein assembles into a receptor complex composed of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, initiating their autophosphorylation. Subsequently, these activated type I receptors engage with SMAD transcriptional regulators, leading to the activation of downstream signaling pathways. Notably, AMHR2/MISRII serves as a receptor for anti-Muellerian hormone, playing a crucial role in mediating the cellular responses triggered by this hormone.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q16671-1 (P18-S144)

Gene ID

269  [NCBI]

Molecular Construction
N-term
AMHR2 (P18-S144)
Accession # Q16671-1
hFc
C-term
Protein Length

Partial

Synonyms
MIS type II receptor; MISRII; MRII; AMHR; MISR2; AMHR2; AMH type II receptor; AMHR2; AMHRII; C14
AA Sequence

PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Predicted Molecular Mass
40.2 kDa
Molecular Weight

Approximately 50-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AMHR2/MISRII Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AMHR2/MISRII Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMHR2/MISRII Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77870
Quantity:
MCE Japan Authorized Agent: