1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Aminopeptidase P2 Protein, Human (HEK293, His)

Aminopeptidase P2 Protein, Human (HEK293, His)

Cat. No.: HY-P7499
Handling Instructions

Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue[1].

Background

Aminopeptidase P2 (XPNPEP2; APP2) is membranebound. Aminopeptidase P2 is a receptor for TMTP1 tumor-homing peptide. APP2 has a much more restricted substrate speciWcity; it fails to hydrolyze XPro dipeptides and cleaves X-Pro-Y- peptides poorly when X is Pro or Gly or when Y is an amino acid with a bulky side chain[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O43895 (H22-A650)

Gene ID
Molecular Construction
N-term
XPNPEP2 (H22-A650)
Accession # O43895
6*His
C-term
Synonyms
rHuAminopeptidase P2, His; XPNPEP2; Aminopeptidase P2
AA Sequence

HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH

Molecular Weight

Approximately 78.0 kDa

Purity

Greater than 80% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Aminopeptidase P2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aminopeptidase P2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7499
Quantity:
MCE Japan Authorized Agent: