Aminopeptidase P2 Protein, Human (HEK293, His)
Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue[1].
Background
Aminopeptidase P2 (XPNPEP2; APP2) is membranebound. Aminopeptidase P2 is a receptor for TMTP1 tumor-homing peptide. APP2 has a much more restricted substrate speciWcity; it fails to hydrolyze XPro dipeptides and cleaves X-Pro-Y- peptides poorly when X is Pro or Gly or when Y is an amino acid with a bulky side chain[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O43895 (H22-A650)
-
Molecular Construction
-
N-term
-
XPNPEP2 (H22-A650)
Accession # O43895 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
XPNPEP2; X-Prolyl Aminopeptidase 2; Xaa-Pro Aminopeptidase 2; Membrane-Bound Aminopeptidase P; X-Prolyl Aminopeptidase (Aminopeptidase P) 2; Membrane-Bound; Aminoacylproline Aminopeptidase; X-Pro Aminopeptidase 2; Membrane-Bound APP; Membrane-Bound AmP; MAmP; AEACE
-
AA Sequence
HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAA
-
Predicted Molecular Mass
71.6 kDa
-
Molecular Weight
Approximately 78 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Erşahin C, et al. Aminopeptidase P isozyme expression in human tissues and peripheral blood mononuclear cell fractions. Arch Biochem Biophys. 2005 Mar 15;435(2):303-10. [Content Brief]
[2]. Li F, et al. XPNPEP2 is associated with lymph node metastasis in prostate cancer patients. Sci Rep. 2019 Jul 11;9(1):10078. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
