Angiopoietin-2 Protein, Mouse (HEK293, Fc)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Angiopoietin-2 Protein, Mouse (HEK293, Fc) is 478 a.a., with molecular weight of 90-120 kDa.

Angiopoietin-2 Protein (ANGPT2) binds to TEK/TIE2 and competes with ANGPT1 for the binding site, thereby modulating ANGPT1 signaling. It has the ability to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers like VEGF, ANGPT2 can cause loosening of cell-matrix contacts, potentially leading to endothelial cell apoptosis and subsequent vascular regression. However, when working in conjunction with VEGF, it can promote endothelial cell migration and proliferation, making it a permissive angiogenic signal. ANGPT2 also plays a role in the regulation of lymphangiogenesis. Additionally, it interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and interacts with ITGA5.

Immobilized Mouse Angiopoietin-2 at 2 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED₅₀ for this effect is 0.8674 μg/mL, corresponding to a specific activity is 1.15×10^3 Unit/mg.

• 
  Immobilized Mouse Angiopoietin-2 at 2 μg/mL (100 μL/well) can bind Biotinylated TIE-2. The ED₅₀ for this effect is 0.8674μg/mL, corresponding to a specific activity is 1.15×10³Unit/mg.

Mouse

HEK293

C-hFc

O35608 (Y19-F496)

11601  [NCBI]

YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

90-120 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.