1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANGPTLs
  5. ANGPTL3/Angiopoietin-like 3 Protein, Human (204a.a, HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Human (204a.a, HEK293, His)

Cat. No.: HY-P7505
Handling Instructions

ANGPTL3/Angiopoietin-like 3 Protein, Human (204a.a, HEK293, His) plays an important role in lipoprotein metabolism. Angiopoietin-like Protein 3 acts as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL). Angiopoietin-like Protein 3 inhibits endothelial lipase hydrolysis of HDL-phospholipid (PL), thereby increasing HDL-PL levels.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $135 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

ANGPTL3/Angiopoietin-like 3 Protein, Human (204a.a, HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

Q9Y5C1 (S17-P220)

Gene ID

27329

Synonyms
rHuAngiopoietin-like Protein 3, His; ANGPTL3; Angiopoietin-like Protein 3
AA Sequence

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH

Molecular Weight

Approximately 30.0 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. The discovery of ANGPTL3 deficiency in mice and humans has stimulated a series of studies which have clarified the role of ANGPTL3 in lipoprotein metabolism. These investigations have suggested that ANGPTL3 may be a novel therapeutic target in the management of dyslipidemias in humans. The results of recent intervention trials aimed at inhibiting ANGPTL3 appear to support this hypothesis.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL3/Angiopoietin-like 3 Protein, Human (204a.a, HEK293, His)
Cat. No.:
HY-P7505
Quantity:
MCE Japan Authorized Agent: