1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 3 Proteins
  5. ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His)

Cat. No.: HY-P7505
SDS COA Handling Instructions

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His) plays an important role in lipoprotein metabolism.Angiopoietin-like Protein 3 acts as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL).Angiopoietin-like Protein 3 inhibits endothelial lipase hydrolysis of HDL-phospholipid (PL), thereby increasing HDL-PL levels.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $240 In-stock
100 μg $410 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His) plays an important role in lipoprotein metabolism.Angiopoietin-like Protein 3 acts as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL).Angiopoietin-like Protein 3 inhibits endothelial lipase hydrolysis of HDL-phospholipid (PL), thereby increasing HDL-PL levels.

Background

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. The discovery of ANGPTL3 deficiency in mice and humans has stimulated a series of studies which have clarified the role of ANGPTL3 in lipoprotein metabolism. These investigations have suggested that ANGPTL3 may be a novel therapeutic target in the management of dyslipidemias in humans. The results of recent intervention trials aimed at inhibiting ANGPTL3 appear to support this hypothesis.

Biological Activity

Immobilized Human at ANGPTL3 2 μg/mL (100 μL/well) can bind Monoclonal Anti-Human ANGPTL3 Antibody, the ED50 of human ANGPTL3 protein is 2.741 ng/mL, corresponding to a specific activity is 3.6483×10^5 units/mg.

  • Immobilized Human at ANGPTL3 2 μg/mL (100 μL/well) can bind Monoclonal Anti-Human ANGPTL3 Antibody, the ED50 of human ANGPTL3 protein is 2.741 ng/mL, corresponding to a specific activity is 3.6483×105 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9Y5C1 (S17-P220)

Gene ID
Molecular Construction
N-term
ANGPTL3 (S17-P220)
Accession # Q9Y5C1
6*His
C-term
Synonyms
rHuAngiopoietin-like Protein 3, His; ANGPTL3; Angiopoietin-like Protein 3
AA Sequence

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95 % as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His)
Cat. No.:
HY-P7505
Quantity:
MCE Japan Authorized Agent: