ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His-Avi)

ANGPTL2/angiopoietin-like 2 protein takes center stage as it induces endothelial cell sprouting through dual autocrine and paracrine mechanisms.This ability underscores its critical role in angiogenesis, where balanced signaling events control the formation of new blood vessels.ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

ANGPTL2/Angiopoietin-like 2 protein takes center stage as it exerts its influence on endothelial cells by inducing sprouting through a dual mechanism of autocrine and paracrine action. The protein's capacity to instigate sprouting underscores its pivotal role in angiogenic processes, where the intricate balance of signaling events governs the formation of new blood vessels. By operating both as an autocrine and paracrine factor, ANGPTL2 plays a crucial role in modulating endothelial cell behavior, contributing to the dynamic and coordinated responses essential for angiogenesis. This multifaceted action positions ANGPTL2 as a key player in the complex regulatory network that orchestrates vascular sprouting, highlighting its significance in the intricate processes of tissue vascularization.

Human LILRB2, hFc Tag captured on Protein A chip, can bind Human ANGPTL2, His Tag with an affinity constant of 0.15-0.22 μM as determined in a SPR assay (Biacore T200).

Human

HEK293

C-Avi;C-His

Q9UKU9-1 (T260-H493)

23452  [NCBI]

Partial

TLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

31-35 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM L-Arginine, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/loucy-cell.html