2. Protéines recombinantes
  3. Cytokines and Growth Factors
  4. Angiopoietins
  5. Angiopoietin Like 3 Proteins
  6. ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His)

ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His)

Cat. No.: HY-P76726
Instruction de manipulation Technical Support

ANGPTL3/Angiopoietin-like 3 is a vascular growth factor and a member of the angiopoietin like protein family. It has high specificity for endothelial cells, performs various other regulatory activities to affect inflammation, and has been proved to have atherosclerosis promoting and atherosclerosis protective effects. NGPTL3/Angiopoietin-like 3 can also inhibit the activity of lipoprotein lipase and induce angiogenesis. ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived ANGPTL3/Angiopoietin-like 3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

ANGPTL3/Angiopoietin-like 3 is a vascular growth factor and a member of the angiopoietin like protein family. It has high specificity for endothelial cells, performs various other regulatory activities to affect inflammation, and has been proved to have atherosclerosis promoting and atherosclerosis protective effects. NGPTL3/Angiopoietin-like 3 can also inhibit the activity of lipoprotein lipase and induce angiogenesis. ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived ANGPTL3/Angiopoietin-like 3 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background

ANGPTL3/Angiopoietin-like 3 is a vascular growth factor, which is highly specific to endothelial cells, performs various other regulatory activities to affect inflammation, and has been proved to have atherosclerosis promoting and atherosclerosis protecting effects[1].
ANGPTL3/Angiopoietin-like 3 can inhibit the activity of lipoprotein lipase in vitro and in vivo, and plays a crucial role in human lipoprotein metabolism. In addition, ANGPTL3/Angiopoietin-like 3 can stimulate the adhesion and migration of endothelial cells and induce angiogenesis by binding to the cell integrin αVβ3. ANGPTL3/Angiopoietin-like 3 also activates protein kinase B and increases the permeability of glomerular endothelial cells [2].
The loss of function, inactivation or down-regulation of ANGPTL3/Angiopoietin-like 3 is related to the significant reduction of plasma TGs, LDL-C and high-density lipoprotein cholesterol (HDL-C) levels, atherosclerosis and the risk of cardiovascular events[3].
Species

Cynomolgus
Source

Sf9 insect cells
Tag

C-His
Accession

A0A2K5UDC5/XP_005543242 (S17-P220)
Gene ID
Molecular Construction
N-term
ANGPTL3 (S17-P220)
Accession # A0A2K5UDC5/XP_005543242
His
C-term
Protein Length

Partial
Synonyms
Angiopoietin-related protein 3; Angiopoietin-5; ANG-5; ANGPT5
AA Sequence

SRIDQDNSSFDSVSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPATPEHPEVTSLKSFVEKQDNSIKDLLQTVEEQYKQLNQQHSQIKEIENQLRMTNIQEPTEISLSSKP

Predicted Molecular Mass
25.2 kDa
Pureté

≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Instruction de manipulation (2659 KB)
Références

ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His)

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
ANGPTL3/Angiopoietin-like 3 Protein, Cynomolgus (sf9, His)
Cat. No.:
HY-P76726
Quantité:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Country or Region *

Adresse e-mail *

     

Numéro de téléphone *

 

Nom de l'organisation *

Remarques

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.