ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, hFc)

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, hFc) is the recombinant human-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-hFc labeled tag.

The ANGPTL7/Angiopoietin-related 7 protein assumes a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it acts as a mediator of dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue essential for the outflow of ocular aqueous humor and the maintenance of intraocular pressure. Additionally, ANGPTL7 serves as a negative regulator of angiogenesis in the cornea, playing a significant role in preserving corneal avascularity and transparency, as suggested by research findings. Structurally, it forms a homotetramer through disulfide linkages, further emphasizing its role in maintaining the structural integrity of the extracellular matrix in ocular tissues.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human LILRB1/CD85j/ILT2 (HY-P70179) at 2 μg/mL can bind Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 (HY-P700852). The ED₅₀ for this effect is 0.1069 μg/mL.

Human

HEK293

C-hFc

O43827 (Q27-P346)

10218  [NCBI]

Full Length of Mature Protein

QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

70-90 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.