1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin-Like 7
  5. ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi)

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P700955
Handling Instructions Technical Support

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi) is the recombinant human-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL7/angiopoietin-related 7 protein plays a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it serves as a mediator for dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue that studies have shown is necessary for aqueous humor outflow and maintenance of intraocular pressure. ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi) is the recombinant human-derived ANGPTL7/Angiopoietin-related 7 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The ANGPTL7/Angiopoietin-related 7 protein assumes a crucial role in the formation and organization of the extracellular matrix. Particularly in the eye, it acts as a mediator of dexamethasone-induced matrix deposition within the trabecular meshwork, a tissue essential for the outflow of ocular aqueous humor and the maintenance of intraocular pressure. Additionally, ANGPTL7 serves as a negative regulator of angiogenesis in the cornea, playing a significant role in preserving corneal avascularity and transparency, as suggested by research findings. Structurally, it forms a homotetramer through disulfide linkages, further emphasizing its role in maintaining the structural integrity of the extracellular matrix in ocular tissues.

Species

Human

Source

HEK293

Tag

C-Avi;C-10*His

Accession

O43827 (Q27-P346)

Gene ID
Molecular Construction
N-term
ANGPTL7 (Q27-P346)
Accession # O43827
10*His-Avi
C-term
Protein Length

Full Length of Mature Protein

Synonyms
angiopoietin-like 7; Angiopoietin-like factor; ANGPTL7; AngX; CDT6
AA Sequence

QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

Predicted Molecular Mass
40.2 kDa
Molecular Weight

Approximately 50-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Supplied as a 0.22μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL7/Angiopoietin-related 7 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P700955
Quantity:
MCE Japan Authorized Agent: