1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-15
  6. Animal-Free BMP-15 Protein, Human (His)

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells. This product is for cell culture use only.

Background

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth and differentiation factor 9B (GDF9B), is a polymorphic ligand protein belonging to the TGFβ family and expresses exclusively in the oocyte[1].
BMP15 is closely related to GDF9, which is essential for early ovarian folliculogenesis[1].
BMP15 and GDF9 involve in the genetic control of follicular development. Their main functions include regulating cellular proliferation/differentiation, follicular survival/atresia, and oocyte maturation, to creat an environment supporting follicle selection and growth[2].
BMP15 involves in p38 MAPK pathway to up-regulate anti-Mullerian hormone (AMH) expression in granulosa cells, which is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles[3].
Otherwise, BMP15 binds HIF-1α/SCF signaling pathway to induce stem cell factor (SCF) expression in human GCs of polycystic ovary syndrome (PCOS) related follicles[4].
BMP-15 is widely found in different animals, while the sequence in human is different from rat (63.66%), and mouse (64.01).

In Vitro

BMP-15 (huamn; 500 ng/mL; 48 h) induces FSHR expression in HGrC1 cells[5].
BMP-15 (huamn; 500 ng/mL; 0-90 min) increases phosphorylation of Smad 1/5/8 in HGrC1 cells[5].

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 16.1 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O95972 (Q268-R392)

Gene ID
Molecular Construction
N-term
BMP-15 (Q268-R392)
Accession # O95972
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Growth/Differentiation Factor-9B; GDF-9B; ODG2; POF4
AA Sequence

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Predicted Molecular Mass
14.9 kDa
Molecular Weight

Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 4.5.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Animal-Free BMP-15 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-15 Protein, Human (His)
Cat. No.:
HY-P700024AF
Quantity:
MCE Japan Authorized Agent: