Animal-Free FGF-11 isoform 1 Protein, Human (His)

FGF-11 isoform 1 Protein likely participates in the development and functioning of the nervous system, suggesting its role in orchestrating intricate processes that contribute to the establishment and maintenance of neural structures and activities. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-11 isoform 1 Protein, Human (His) is 225 a.a., with molecular weight of ~25.81 kDa.

FGF-11 isoform 1 Protein

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.

Human

E. coli

C-His

Q92914 (M1-P225)

2256  [NCBI]

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Approximately 25.81 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.