1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-11
  6. Animal-Free FGF-11 isoform 1 Protein, Human (His)

Animal-Free FGF-11 isoform 1 Protein, Human (His)

Cat. No.: HY-P700054AF
Instrucciones de manejo Technical Support

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

FGF-11 isoform 1 Protein is believed to play a significant role in the development and functioning of the nervous system. Its presence suggests involvement in the intricate processes responsible for establishing and maintaining neural structures and activities. As a member of the fibroblast growth factor (FGF) family, this isoform likely contributes to neural growth, differentiation, and communication. Although further research is required to fully comprehend the precise mechanisms and functions of FGF-11 isoform 1 Protein, its potential importance in neural development highlights its significance as a key player in the intricate orchestration of the nervous system.

Actividad biológica

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q92914 (M1-P225)

Gene ID
Molecular Construction
N-term
FGF-11 isoform 1 (M1-P225)
Accession # Q92914
6*His
C-term
Protein Length

Full Length

Synonyms
Fibroblast growth factor 11; FHF-3; FHF3; Fibroblast growth factor homologous factor 3
AA Sequence

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Predicted Molecular Mass
25.8 kDa
Peso molecular

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Animal-Free FGF-11 isoform 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Animal-Free FGF-11 isoform 1 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Animal-Free FGF-11 isoform 1 Protein, Human (His)
Cat. No.:
HY-P700054AF
Cantidad:
MCE Japan Authorized Agent: