Animal-Free FGF-11 isoform 2 Protein, Human (His)

FGF-11 isoform 2 protein is a member of the fibroblast growth factor family, characterized by broad mitotic and cell survival activities, affecting embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth. Its specific function has not yet been determined, but the expression pattern of its mouse homolog suggests a role in nervous system development. Animal-Free FGF-11 isoform 2 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

The protein encoded by this gene belongs to the fibroblast growth factor (FGF) family, known for its broad mitogenic and cell survival activities involved in various biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth. While the specific function of this gene remains to be determined, the expression pattern of its mouse homolog suggests a role in nervous system development. Alternative splicing results in the generation of multiple transcript variants. This FGF-11 isoform 2 protein exhibits broad expression, with notable levels detected in the adrenal gland (RPKM 9.9), skin (RPKM 7.0), and 14 other tissues.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL.

Human

E. coli

C-6*His

NP_001290389.1 (M1-P166)

2256  [NCBI]

Full Length

MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.