Animal-Free FGF-18 Protein, Human (His)

FGF-18 Protein intricately regulates cell proliferation, differentiation, and migration, crucial in normal ossification and bone development for skeletal maturation. It stimulates hepatic and intestinal proliferation, showcasing versatile functions. Interactions with FGFR3 and FGFR4 underscore FGF-18 Protein's significance in modulating intricate signaling pathways for fundamental tissue development and homeostasis. Animal-Free FGF-18 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-18 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-18 Protein, Human (His) is 173 a.a., with molecular weight of ~21.11 kDa.

FGF-18 Protein assumes a pivotal role in intricately regulating cell proliferation, differentiation, and migration. Its indispensability extends to the orchestration of normal ossification and bone development, emphasizing its crucial involvement in skeletal maturation. Additionally, FGF-18 Protein demonstrates the ability to stimulate hepatic and intestinal proliferation, highlighting its versatile functions across different tissues. The mediation of these cellular processes is facilitated through interactions with FGFR3 and FGFR4, underscoring the significance of FGF-18 Protein in modulating intricate signaling pathways that contribute to fundamental processes in tissue development and homeostasis.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is 1.3-2.0 ng/mL. The specific activity of recombinant human FGF-18 is > 5 x 10⁵ IU/mg.

Human

E. coli

C-His

O76093 (A27-R199)

8817  [NCBI]

MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Approximately 21.11 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.