1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Animal-Free FLT3LG Protein, Mouse (His)

FLT3LG protein, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. Animal-Free FLT3LG Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFLT3LG protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FLT3LG protein, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. Animal-Free FLT3LG Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFLT3LG protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The FLT3LG protein acts as a potent stimulator, fostering the proliferation of early hematopoietic cells through the activation of FLT3. Exhibiting synergistic effects, particularly in its soluble isoform, this homodimeric protein collaborates effectively with various colony-stimulating factors and interleukins. Its role in promoting the expansion and differentiation of hematopoietic progenitor cells underscores its significance in orchestrating key processes within the hematopoietic system.

Biological Activity

Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <2 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P49772 (G27-R188)

Gene ID
Molecular Construction
N-term
FLT3LG (G27-R188)
Accession # P49772
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rMuFlt-3 Ligand, His; Fms-related tyrosine kinase 3 ligand; SL cytokine; Flt3lg
AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR

Predicted Molecular Mass
19.3 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FLT3LG Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Animal-Free FLT3LG Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FLT3LG Protein, Mouse (His)
Cat. No.:
HY-P700177AF
Quantity:
MCE Japan Authorized Agent: