Animal-Free Galectin-4/LGALS4 Protein, Human (His)

Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Animal-Free Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-4/LGALS4 protein, expressed by E. coli , with N-His, N-His labeled tag. This product is for cell culture use only.

Galectin-4/LGALS4 is a lactose-binding galectin protein that exhibits an affinity for a variety of sugars. It has been implicated in the formation of adherens junctions, indicating its potential role in cellular adhesion processes. Notably, this protein functions as a monomer, emphasizing its independent molecular state and suggesting that it may exert its biological effects through individual interactions rather than as part of a larger complex.

Measured by its ability to agglutinate human red blood cells. The ED₅₀ for this effect is <8 µg/mL.

Human

E. coli

N-6*His

P56470 (A2-I323)

3960  [NCBI]

Partial

AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

Approximately 36.8 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.