Animal-Free Galectin-9/LGALS9 Protein, Human (His)

Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Animal-Free Galectin-9/LGALS9 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-9/LGALS9 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).

Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED₅₀ for this effect is <3 μg/mL.

Human

E. coli

N-6*His

O00182-2 (A2-T323)

3965  [NCBI]

Full Length

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Approximately 36.7 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.